UniProt ID | YBEY_HUMAN | |
---|---|---|
UniProt AC | P58557 | |
Protein Name | Endoribonuclease YbeY {ECO:0000305} | |
Gene Name | YBEY | |
Organism | Homo sapiens (Human). | |
Sequence Length | 167 | |
Subcellular Localization | Nucleus . | |
Protein Description | Single strand-specific metallo-endoribonuclease involved in rRNA maturation.. | |
Protein Sequence | MSLVIRNLQRVIPIRRAPLRSKIEIVRRILGVQKFDLGIICVDNKNIQHINRIYRDRNVPTDVLSFPFHEHLKAGEFPQPDFPDDYNLGDIFLGVEYIFHQCKENEDYNDVLTVTATHGLCHLLGFTHGTEAEWQQMFQKEKAVLDELGRRTGTRLQPLTRGLFGGS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSLVIRNLQ ------CCCHHHCHH | 31.20 | 30622161 | |
142 | Ubiquitination | QQMFQKEKAVLDELG HHHHHHHHHHHHHHH | 51.32 | - | |
152 | Phosphorylation | LDELGRRTGTRLQPL HHHHHHHCCCCCCCC | 41.36 | 24719451 | |
154 | Phosphorylation | ELGRRTGTRLQPLTR HHHHHCCCCCCCCCC | 27.82 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YBEY_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YBEY_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YBEY_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...