MTG1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MTG1_HUMAN
• UniProt AC: Q9BT17
• Protein Name: Mitochondrial ribosome-associated GTPase 1
• Gene Name: MTG1
• Organism: Homo sapiens (Human).
• Sequence Length: 334
• Subcellular Localization: Mitochondrion inner membrane ; Peripheral membrane protein ; Matrix side .
• Protein Description: Plays a role in the regulation of the mitochondrial ribosome assembly and of translational activity. Displays mitochondrial GTPase activity..
• Protein Sequence: MRLTPRALCSAAQAAWRENFPLCGRDVARWFPGHMAKGLKKMQSSLKLVDCIIEVHDARIPLSGRNPLFQETLGLKPHLLVLNKMDLADLTEQQKIMQHLEGEGLKNVIFTNCVKDENVKQIIPMVTELIGRSHRYHRKENLEYCIMVIGVPNVGKSSLINSLRRQHLRKGKATRVGGEPGITRAVMSKIQVSERPLMFLLDTPGVLAPRIESVETGLKLALCGTVLDHLVGEETMADYLLYTLNKHQRFGYVQHYGLGSACDNVERVLKSVAVKLGKTQKVKVLTGTGNVNIIQPNYPAAARDFLQTFRRGLLGSVMLDLDVLRGHPPAETLP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
91	Phosphorylation	KMDLADLTEQQKIMQ CCCHHHHHHHHHHHH	32.09	-
106	Ubiquitination	HLEGEGLKNVIFTNC HHCCCCCCCEEEECC	61.09	29967540
115	Ubiquitination	VIFTNCVKDENVKQI EEEECCCCCCCHHHH	62.62	29967540
127	Phosphorylation	KQIIPMVTELIGRSH HHHHHHHHHHHCCCC	20.87	-
195	Methylation	SKIQVSERPLMFLLD HHCCCCCCCEEEEEC	23.34	115483993
213	Phosphorylation	VLAPRIESVETGLKL CCCCCCCHHHHHHHH	23.92	23403867
216	Phosphorylation	PRIESVETGLKLALC CCCCHHHHHHHHHHH	45.73	23403867
252	Phosphorylation	NKHQRFGYVQHYGLG CCCCCCCCCCCCCCC	8.33	29496907
256	Phosphorylation	RFGYVQHYGLGSACD CCCCCCCCCCCHHHH	9.28	29496907
278	Acetylation	SVAVKLGKTQKVKVL HHHHHCCCCCEEEEE	59.21	30590497
332	Phosphorylation	RGHPPAETLP----- CCCCCHHCCC-----	46.57	20886841

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MTG1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MTG1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MTG1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.