1A03_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: 1A03_HUMAN
• UniProt AC: P04439
• Protein Name: HLA class I histocompatibility antigen, A-3 alpha chain
• Gene Name: HLA-A
• Organism: Homo sapiens (Human).
• Sequence Length: 365
• Subcellular Localization: Membrane; Single-pass type I membrane protein.
• Protein Description: Involved in the presentation of foreign antigens to the immune system..
• Protein Sequence: MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of 1A03_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of 1A03_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of 1A03_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
168	Ubiquitination	176 (8)	E ⇒ A;G;V	rs9256983	Pneumonia	28928442

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UGGG1_HUMAN	UGGT1	physical	17353931
CD8A_HUMAN	CD8A	physical	9177355
CD8A_HUMAN	CD8A	physical	10809759
COPB_HUMAN	COPB1	physical	11884415
COPG1_HUMAN	COPG1	physical	11884415
TPSN_HUMAN	TAPBP	physical	11884415
TAP1_HUMAN	TAP1	physical	11884415
SYVN1_HUMAN	SYVN1	physical	21245296
UB2J1_HUMAN	UBE2J1	physical	21245296
DERL1_HUMAN	DERL1	physical	21245296
PSMD2_HUMAN	PSMD2	physical	21245296
MAGA4_HUMAN	MAGEA4	physical	21815906
BAP31_HUMAN	BCAP31	physical	17056546
B2MG_HUMAN	B2M	physical	8805302
STAT3_HUMAN	STAT3	physical	21988832
GNAS3_HUMAN	GNAS	physical	9914489
GNAS2_HUMAN	GNAS	physical	9914489
ALEX_HUMAN	GNAS	physical	9914489
GNAS1_HUMAN	GNAS	physical	9914489
BAG6_HUMAN	BAG6	physical	21636303
MEOX2_HUMAN	MEOX2	physical	24722188

Drug and Disease Associations

• Kegg Disease
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.