CD8A_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CD8A_HUMAN
• UniProt AC: P01732
• Protein Name: T-cell surface glycoprotein CD8 alpha chain
• Gene Name: CD8A
• Organism: Homo sapiens (Human).
• Sequence Length: 235
• Subcellular Localization: Isoform 1: Cell membrane ; Single-pass type I membrane protein. CD8A localizes to lipid rafts only when associated with its partner CD8B.; Isoform 2: Secreted .
• Protein Description: Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism allowing conjugation and lysis of multiple target cells. CD8A homodimer molecules also promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells..
• Protein Sequence: MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
66	Phosphorylation	QPRGAAASPTFLLYL CCCCCCCCCEEHHHC	21.53	22468782
86	Phosphorylation	KAAEGLDTQRFSGKR CCCCCCCCCCCCCCC	27.04	22468782
140	Phosphorylation	LPAKPTTTPAPRPPT CCCCCCCCCCCCCCC	21.67	17929957
154	Phosphorylation	TPAPTIASQPLSLRP CCCCCCCCCCCCCCH	28.60	17929957
158 (in isoform 2)	Phosphorylation	-	29.08	-
158	Phosphorylation	TIASQPLSLRPEACR CCCCCCCCCCHHHCC	29.08	-
158	O-linked_Glycosylation	TIASQPLSLRPEACR CCCCCCCCCCHHHCC	29.08	OGP
190 (in isoform 2)	Ubiquitination	-	15.36	-
206	S-palmitoylation	SLVITLYCNHRNRRR HHHHHHHCCCCCCCC	3.78	17341584
224	Phosphorylation	CPRPVVKSGDKPSLS CCCCCCCCCCCCCCC	40.38	29978859
229	Phosphorylation	VKSGDKPSLSARYV- CCCCCCCCCCCCCC-	40.47	23401153
231	Phosphorylation	SGDKPSLSARYV--- CCCCCCCCCCCC---	18.29	29978859

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	LNX1	Q8TBB1	PMID:22045731

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CD8A_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CD8A_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CD8B_HUMAN	CD8B	physical	9550407
CD8A_HUMAN	CD8A	physical	9550407
CD8A_HUMAN	CD8A	physical	8127870
CD59_HUMAN	CD59	physical	1377690
LNX2_HUMAN	LNX2	physical	22045731
LNX1_HUMAN	LNX1	physical	22045731
CDK1_HUMAN	CDK1	physical	21988832
COPA_HUMAN	COPA	physical	25894502

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.