| UniProt ID | GBG4_HUMAN | |
|---|---|---|
| UniProt AC | P50150 | |
| Protein Name | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4 | |
| Gene Name | GNG4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 75 | |
| Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
| Protein Description | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.. | |
| Protein Sequence | MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKFFCTIL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Phosphorylation | --MKEGMSNNSTTSI --CCCCCCCCCCCCH | 43.65 | 27732954 | |
| 9 | Phosphorylation | KEGMSNNSTTSISQA CCCCCCCCCCCHHHH | 36.99 | 27732954 | |
| 10 | Phosphorylation | EGMSNNSTTSISQAR CCCCCCCCCCHHHHH | 27.04 | 27732954 | |
| 11 | Phosphorylation | GMSNNSTTSISQARK CCCCCCCCCHHHHHH | 24.71 | 27732954 | |
| 12 | Phosphorylation | MSNNSTTSISQARKA CCCCCCCCHHHHHHH | 21.97 | 27732954 | |
| 14 | Phosphorylation | NNSTTSISQARKAVE CCCCCCHHHHHHHHH | 19.97 | 27732954 | |
| 24 | Ubiquitination | RKAVEQLKMEACMDR HHHHHHHHHHHHHHH | 34.10 | - | |
| 72 | Methylation | FREKKFFCTIL---- CCCCCCEEEEC---- | 2.32 | 7665596 | |
| 72 | Geranylgeranylation | FREKKFFCTIL---- CCCCCCEEEEC---- | 2.32 | 7665596 | |
| 72 | Geranylgeranylation | FREKKFFCTIL---- CCCCCCEEEEC---- | 2.32 | 7665596 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GBG4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GBG4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GBG4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GNB5_HUMAN | GNB5 | physical | 8636150 | |
| GBB_SCHPO | git5 | physical | 16884933 | |
| GBB1_HUMAN | GNB1 | physical | 8636150 | |
| GBB2_HUMAN | GNB2 | physical | 8636150 | |
| GBB3_HUMAN | GNB3 | physical | 8636150 | |
| GBB4_HUMAN | GNB4 | physical | 8636150 | |
| GBB1_HUMAN | GNB1 | physical | 19168127 | |
| GBB2_HUMAN | GNB2 | physical | 19168127 | |
| GBB3_HUMAN | GNB3 | physical | 19168127 | |
| TFP11_HUMAN | TFIP11 | physical | 25416956 | |
| USBP1_HUMAN | USHBP1 | physical | 25416956 | |
| GNAI3_HUMAN | GNAI3 | physical | 28514442 | |
| GNAI1_HUMAN | GNAI1 | physical | 28514442 | |
| GNAS3_HUMAN | GNAS | physical | 28514442 | |
| GNAS2_HUMAN | GNAS | physical | 28514442 | |
| ALEX_HUMAN | GNAS | physical | 28514442 | |
| GNAS1_HUMAN | GNAS | physical | 28514442 | |
| GNAI2_HUMAN | GNAI2 | physical | 28514442 | |
| GBB4_HUMAN | GNB4 | physical | 28514442 | |
| MSPD2_HUMAN | MOSPD2 | physical | 28514442 | |
| GNAQ_HUMAN | GNAQ | physical | 28514442 | |
| PHLP_HUMAN | PDCL | physical | 28514442 | |
| GBB1_HUMAN | GNB1 | physical | 28514442 | |
| GNA13_HUMAN | GNA13 | physical | 28514442 | |
| GNA11_HUMAN | GNA11 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Methylation | |
| Reference | PubMed |
| "Isolation of cDNA clones encoding eight different human G proteingamma subunits, including three novel forms designated the gamma 4,gamma 10, and gamma 11 subunits."; Ray K., Kunsch C., Bonner L.M., Robishaw J.D.; J. Biol. Chem. 270:21765-21771(1995). Cited for: NUCLEOTIDE SEQUENCE [MRNA], ISOPRENYLATION AT CYS-72, AND METHYLATIONAT CYS-72. | |
| Prenylation | |
| Reference | PubMed |
| "Isolation of cDNA clones encoding eight different human G proteingamma subunits, including three novel forms designated the gamma 4,gamma 10, and gamma 11 subunits."; Ray K., Kunsch C., Bonner L.M., Robishaw J.D.; J. Biol. Chem. 270:21765-21771(1995). Cited for: NUCLEOTIDE SEQUENCE [MRNA], ISOPRENYLATION AT CYS-72, AND METHYLATIONAT CYS-72. | |