UniProt ID | GBG4_HUMAN | |
---|---|---|
UniProt AC | P50150 | |
Protein Name | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4 | |
Gene Name | GNG4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 75 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.. | |
Protein Sequence | MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKFFCTIL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MKEGMSNNSTTSI --CCCCCCCCCCCCH | 43.65 | 27732954 | |
9 | Phosphorylation | KEGMSNNSTTSISQA CCCCCCCCCCCHHHH | 36.99 | 27732954 | |
10 | Phosphorylation | EGMSNNSTTSISQAR CCCCCCCCCCHHHHH | 27.04 | 27732954 | |
11 | Phosphorylation | GMSNNSTTSISQARK CCCCCCCCCHHHHHH | 24.71 | 27732954 | |
12 | Phosphorylation | MSNNSTTSISQARKA CCCCCCCCHHHHHHH | 21.97 | 27732954 | |
14 | Phosphorylation | NNSTTSISQARKAVE CCCCCCHHHHHHHHH | 19.97 | 27732954 | |
24 | Ubiquitination | RKAVEQLKMEACMDR HHHHHHHHHHHHHHH | 34.10 | - | |
72 | Methylation | FREKKFFCTIL---- CCCCCCEEEEC---- | 2.32 | 7665596 | |
72 | Geranylgeranylation | FREKKFFCTIL---- CCCCCCEEEEC---- | 2.32 | 7665596 | |
72 | Geranylgeranylation | FREKKFFCTIL---- CCCCCCEEEEC---- | 2.32 | 7665596 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GBG4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GBG4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GBG4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GNB5_HUMAN | GNB5 | physical | 8636150 | |
GBB_SCHPO | git5 | physical | 16884933 | |
GBB1_HUMAN | GNB1 | physical | 8636150 | |
GBB2_HUMAN | GNB2 | physical | 8636150 | |
GBB3_HUMAN | GNB3 | physical | 8636150 | |
GBB4_HUMAN | GNB4 | physical | 8636150 | |
GBB1_HUMAN | GNB1 | physical | 19168127 | |
GBB2_HUMAN | GNB2 | physical | 19168127 | |
GBB3_HUMAN | GNB3 | physical | 19168127 | |
TFP11_HUMAN | TFIP11 | physical | 25416956 | |
USBP1_HUMAN | USHBP1 | physical | 25416956 | |
GNAI3_HUMAN | GNAI3 | physical | 28514442 | |
GNAI1_HUMAN | GNAI1 | physical | 28514442 | |
GNAS3_HUMAN | GNAS | physical | 28514442 | |
GNAS2_HUMAN | GNAS | physical | 28514442 | |
ALEX_HUMAN | GNAS | physical | 28514442 | |
GNAS1_HUMAN | GNAS | physical | 28514442 | |
GNAI2_HUMAN | GNAI2 | physical | 28514442 | |
GBB4_HUMAN | GNB4 | physical | 28514442 | |
MSPD2_HUMAN | MOSPD2 | physical | 28514442 | |
GNAQ_HUMAN | GNAQ | physical | 28514442 | |
PHLP_HUMAN | PDCL | physical | 28514442 | |
GBB1_HUMAN | GNB1 | physical | 28514442 | |
GNA13_HUMAN | GNA13 | physical | 28514442 | |
GNA11_HUMAN | GNA11 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Methylation | |
Reference | PubMed |
"Isolation of cDNA clones encoding eight different human G proteingamma subunits, including three novel forms designated the gamma 4,gamma 10, and gamma 11 subunits."; Ray K., Kunsch C., Bonner L.M., Robishaw J.D.; J. Biol. Chem. 270:21765-21771(1995). Cited for: NUCLEOTIDE SEQUENCE [MRNA], ISOPRENYLATION AT CYS-72, AND METHYLATIONAT CYS-72. | |
Prenylation | |
Reference | PubMed |
"Isolation of cDNA clones encoding eight different human G proteingamma subunits, including three novel forms designated the gamma 4,gamma 10, and gamma 11 subunits."; Ray K., Kunsch C., Bonner L.M., Robishaw J.D.; J. Biol. Chem. 270:21765-21771(1995). Cited for: NUCLEOTIDE SEQUENCE [MRNA], ISOPRENYLATION AT CYS-72, AND METHYLATIONAT CYS-72. |