dbPTM

GBB_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GBB_SCHPO
UniProt AC	Q10282
Protein Name	Guanine nucleotide-binding protein subunit beta
Gene Name	git5
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	305
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Required for adenylate cyclase activation..
Protein Sequence	MDSGSRVNVNIQGTRVLKNKLGKIPDIDISTDGKYLLSASTNDVLLVWDLHTSNKVAFFEAPSVWIMTCAFSPSTKSIAAGGLNNFCVVYDTSVPDADPVELVGHAGFVSCCKYVDDGHLLTGSGDKTCMFWDIEQAKAISVLKGHEMDIVSLDFLPSNPNLFVTGGCDKLAKLWDLRAAYCCATFPGNTSDINSISFFPSNADFVTGAEDGIARCFDIRASAEIFQYSSPSSSPINSVLFSKSGKLLFIAKDKTCEVWDSISSKTITSLTGHENRISSLALTSDGTMLATGSWDECVRLWSSSG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of GBB_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GBB_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GBB_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GBB_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GPA2_SCHPO	gpa2	genetic	11238401
GPA2_SCHPO	gpa2	genetic	10747045
RAS_SCHPO	ras1	genetic	8804400
GPA2_SCHPO	gpa2	genetic	20139237
GBG_SCHPO	git11	physical	11238401
PYP1_SCHPO	pyp1	genetic	8832414
GPA2_SCHPO	gpa2	genetic	8001792
GPA2_SCHPO	gpa2	genetic	11014802
CYAA_SCHPO	cyr1	genetic	1849107
GAD8_SCHPO	gad8	genetic	24928510

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GBB_SCHPO

Related Literatures of Post-Translational Modification