| UniProt ID | GBG_SCHPO | |
|---|---|---|
| UniProt AC | O94309 | |
| Protein Name | Guanine nucleotide-binding protein subunit gamma | |
| Gene Name | git11 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 72 | |
| Subcellular Localization |
Membrane Peripheral membrane protein. |
|
| Protein Description | ||
| Protein Sequence | METEALLNEKISVQQARQEFANYANNIPEPMMVSVAPPKANPSVSSKTKQQQHFKPGKATKDKATTKCCTIS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 12 | Phosphorylation | ALLNEKISVQQARQE HHHHHCCCHHHHHHH | 25.58 | 21712547 | |
| 23 | Phosphorylation | ARQEFANYANNIPEP HHHHHHHHHHCCCCC | 13.79 | 21712547 | |
| 43 | Phosphorylation | APPKANPSVSSKTKQ CCCCCCCCCCCCHHH | 34.14 | 27738172 | |
| 46 | Phosphorylation | KANPSVSSKTKQQQH CCCCCCCCCHHHHHC | 42.03 | 27738172 | |
| 68 | S-palmitoylation | KDKATTKCCTIS--- CCCCCCCCEECC--- | 2.02 | - | |
| 69 | Methylation | DKATTKCCTIS---- CCCCCCCEECC---- | 3.95 | - | |
| 69 | Farnesylation | DKATTKCCTIS---- CCCCCCCEECC---- | 3.95 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GBG_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GBG_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GBG_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GPA2_SCHPO | gpa2 | genetic | 11238401 | |
| GBB1_HUMAN | GNB1 | physical | 16884933 | |
| GBB2_HUMAN | GNB2 | physical | 16884933 | |
| GBB3_HUMAN | GNB3 | physical | 16884933 | |
| GBB4_HUMAN | GNB4 | physical | 16884933 | |
| GNB5_HUMAN | GNB5 | physical | 16884933 | |
| GBB_SCHPO | git5 | physical | 16884933 | |
| GPA2_SCHPO | gpa2 | genetic | 20139237 | |
| GBB_SCHPO | git5 | physical | 11238401 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
