UniProt ID | GBG5_HUMAN | |
---|---|---|
UniProt AC | P63218 | |
Protein Name | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 | |
Gene Name | GNG5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 68 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.. | |
Protein Sequence | MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSGSSSVAA ------CCCHHHHHH | 47.59 | 29255136 | |
2 | Acetylation | ------MSGSSSVAA ------CCCHHHHHH | 47.59 | 20068231 | |
4 | Phosphorylation | ----MSGSSSVAAMK ----CCCHHHHHHHH | 16.48 | 29255136 | |
5 | Phosphorylation | ---MSGSSSVAAMKK ---CCCHHHHHHHHH | 32.15 | 29255136 | |
6 | Phosphorylation | --MSGSSSVAAMKKV --CCCHHHHHHHHHH | 19.92 | 23401153 | |
11 | Acetylation | SSSVAAMKKVVQQLR HHHHHHHHHHHHHHH | 37.38 | 25953088 | |
11 | Ubiquitination | SSSVAAMKKVVQQLR HHHHHHHHHHHHHHH | 37.38 | 33845483 | |
12 | Ubiquitination | SSVAAMKKVVQQLRL HHHHHHHHHHHHHHH | 34.26 | 24816145 | |
18 | Methylation | KKVVQQLRLEAGLNR HHHHHHHHHHHCCCC | 26.58 | - | |
27 | Ubiquitination | EAGLNRVKVSQAAAD HHCCCCHHHHHHHHH | 32.69 | 21906983 | |
36 | Ubiquitination | SQAAADLKQFCLQNA HHHHHHHHHHHHHHC | 41.71 | 23000965 | |
53 | Phosphorylation | DPLLTGVSSSTNPFR CCCCCCCCCCCCCCC | 21.66 | 28348404 | |
54 | Phosphorylation | PLLTGVSSSTNPFRP CCCCCCCCCCCCCCC | 38.48 | 26657352 | |
55 | Phosphorylation | LLTGVSSSTNPFRPQ CCCCCCCCCCCCCCH | 25.38 | 28348404 | |
56 | Phosphorylation | LTGVSSSTNPFRPQK CCCCCCCCCCCCCHH | 49.19 | 26657352 | |
65 | Methylation | PFRPQKVCSFL---- CCCCHHHHHCC---- | 2.83 | - | |
65 | Geranylgeranylation | PFRPQKVCSFL---- CCCCHHHHHCC---- | 2.83 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GBG5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GBG5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GBG5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GNB5_HUMAN | GNB5 | physical | 8636150 | |
GBB1_HUMAN | GNB1 | physical | 8636150 | |
GBB2_HUMAN | GNB2 | physical | 8636150 | |
GBB3_HUMAN | GNB3 | physical | 8636150 | |
GBB4_HUMAN | GNB4 | physical | 8636150 | |
GBB1_HUMAN | GNB1 | physical | 19168127 | |
GBB2_HUMAN | GNB2 | physical | 19168127 | |
GBB3_HUMAN | GNB3 | physical | 19168127 | |
GBB3_HUMAN | GNB3 | physical | 22940628 | |
GOGA2_HUMAN | GOLGA2 | physical | 25416956 | |
K1H1_HUMAN | KRT31 | physical | 25416956 | |
MDFI_HUMAN | MDFI | physical | 25416956 | |
TRAF1_HUMAN | TRAF1 | physical | 25416956 | |
AMOL2_HUMAN | AMOTL2 | physical | 25416956 | |
EP15R_HUMAN | EPS15L1 | physical | 25416956 | |
K1C40_HUMAN | KRT40 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Exploring proteomes and analyzing protein processing by massspectrometric identification of sorted N-terminal peptides."; Gevaert K., Goethals M., Martens L., Van Damme J., Staes A.,Thomas G.R., Vandekerckhove J.; Nat. Biotechnol. 21:566-569(2003). Cited for: PROTEIN SEQUENCE OF 2-18, AND ACETYLATION AT SER-2. |