UniProt ID | CDN2C_HUMAN | |
---|---|---|
UniProt AC | P42773 | |
Protein Name | Cyclin-dependent kinase 4 inhibitor C | |
Gene Name | CDKN2C | |
Organism | Homo sapiens (Human). | |
Sequence Length | 168 | |
Subcellular Localization | ||
Protein Description | Interacts strongly with CDK6, weakly with CDK4. Inhibits cell growth and proliferation with a correlated dependence on endogenous retinoblastoma protein RB.. | |
Protein Sequence | MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
46 | Ubiquitination | RTALQVMKLGNPEIA HHHHHHHHHCCHHHH | 55.15 | - | |
66 | Ubiquitination | RGANPDLKDRTGFAV CCCCCCCCCCCCEEH | 53.17 | - | |
136 | Ubiquitination | NVGHRNHKGDTACDL CCCCCCCCCCCHHHH | 63.13 | 2190698 | |
139 | Phosphorylation | HRNHKGDTACDLARL CCCCCCCCHHHHHHH | 37.54 | 22210691 | |
154 | Phosphorylation | YGRNEVVSLMQANGA HCCHHHHHHHHHCCC | 24.25 | 22210691 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CDN2C_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDN2C_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDN2C_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...