dbPTM

CDN2C_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CDN2C_HUMAN
UniProt AC	P42773
Protein Name	Cyclin-dependent kinase 4 inhibitor C
Gene Name	CDKN2C
Organism	Homo sapiens (Human).
Sequence Length	168
Subcellular Localization
Protein Description	Interacts strongly with CDK6, weakly with CDK4. Inhibits cell growth and proliferation with a correlated dependence on endogenous retinoblastoma protein RB..
Protein Sequence	MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
46	Ubiquitination	RTALQVMKLGNPEIA HHHHHHHHHCCHHHH	55.15	-
66	Ubiquitination	RGANPDLKDRTGFAV CCCCCCCCCCCCEEH	53.17	-
136	Ubiquitination	NVGHRNHKGDTACDL CCCCCCCCCCCHHHH	63.13	2190698
139	Phosphorylation	HRNHKGDTACDLARL CCCCCCCCHHHHHHH	37.54	22210691
154	Phosphorylation	YGRNEVVSLMQANGA HCCHHHHHHHHHCCC	24.25	22210691

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CDN2C_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CDN2C_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CDN2C_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDK4_HUMAN	CDK4	physical	17353931
CDK6_HUMAN	CDK6	physical	17353931
QPCTL_HUMAN	QPCTL	physical	17353931
APLP1_HUMAN	APLP1	physical	16169070
CSN6_HUMAN	COPS6	physical	16169070
GDF9_HUMAN	GDF9	physical	16169070
CC90B_HUMAN	CCDC90B	physical	16169070
RBM48_HUMAN	RBM48	physical	16169070
NC2A_HUMAN	DRAP1	physical	16169070
TLE1_HUMAN	TLE1	physical	16169070
LRIF1_HUMAN	LRIF1	physical	16169070
P53_HUMAN	TP53	physical	16169070
U119A_HUMAN	UNC119	physical	16169070
CDK6_HUMAN	CDK6	physical	8001816
CDK4_HUMAN	CDK4	physical	8001816
PP2AA_HUMAN	PPP2CA	physical	21988832
LY96_HUMAN	LY96	physical	21988832
GOPC_HUMAN	GOPC	physical	21988832
REL_HUMAN	REL	physical	25416956
ITF2_HUMAN	TCF4	physical	25416956
HTF4_HUMAN	TCF12	physical	25416956
SAHH2_HUMAN	AHCYL1	physical	25416956
NAGK_HUMAN	NAGK	physical	25416956
NIF3L_HUMAN	NIF3L1	physical	25416956
ANGL4_HUMAN	ANGPTL4	physical	25640309
GREB1_HUMAN	GREB1	physical	25640309
MTA3_HUMAN	MTA3	physical	25640309
ARY2_HUMAN	NAT2	physical	25640309
SG2A2_HUMAN	SCGB2A2	physical	25640309
ST14_HUMAN	ST14	physical	25640309
CDK4_HUMAN	CDK4	physical	28514442
CDK6_HUMAN	CDK6	physical	28514442
PYM1_HUMAN	WIBG	physical	28514442
MEN1_HUMAN	MEN1	genetic	17145768

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CDN2C_HUMAN

Related Literatures of Post-Translational Modification