UniProt ID | SG2A2_HUMAN | |
---|---|---|
UniProt AC | Q13296 | |
Protein Name | Mammaglobin-A | |
Gene Name | SCGB2A2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 93 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
38 | Phosphorylation | KTINPQVSKTEYKEL HHCCCCCCHHHHHHH | 28.72 | 27251275 | |
53 | N-linked_Glycosylation | LQEFIDDNATTNAID HHHHHCCCCCCCHHH | 35.12 | UniProtKB CARBOHYD | |
68 | N-linked_Glycosylation | ELKECFLNQTDETLS HHHHHHHCCCCHHHH | 23.58 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SG2A2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SG2A2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SG2A2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...