UniProt ID | CRLF1_HUMAN | |
---|---|---|
UniProt AC | O75462 | |
Protein Name | Cytokine receptor-like factor 1 | |
Gene Name | CRLF1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 422 | |
Subcellular Localization | Secreted . | |
Protein Description | Cytokine receptor subunit, possibly playing a regulatory role in the immune system and during fetal development. May be involved in nervous system development.. | |
Protein Sequence | MPAGRRGPAAQSARRPPPLLPLLLLLCVLGAPRAGSGAHTAVISPQDPTLLIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARDGSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGACEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGTARGPAR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
92 | N-linked_Glycosylation | PELSRVLNASTLALA HHHHHHHCHHHHHHH | 29.05 | UniProtKB CARBOHYD | |
104 | N-linked_Glycosylation | ALALANLNGSRQRSG HHHHHHCCCCCCCCC | 46.32 | UniProtKB CARBOHYD | |
140 | N-linked_Glycosylation | LPPEKPVNISCWSKN CCCCCCCEEEEECCC | 29.05 | UniProtKB CARBOHYD | |
168 | N-linked_Glycosylation | GETFLHTNYSLKYKL CEEEEEECEEEEEEE | 17.41 | UniProtKB CARBOHYD | |
170 | Phosphorylation | TFLHTNYSLKYKLRW EEEEECEEEEEEEEE | 22.06 | 24719451 | |
219 | Phosphorylation | EATNRLGSARSDVLT HHHHCCCCCCCCCEE | 25.71 | - | |
272 | Phosphorylation | DFLFQAKYQIRYRVE HHHHEEEEEEEEEEC | 16.52 | 18083107 | |
281 | Phosphorylation | IRYRVEDSVDWKVVD EEEEECCCCCEEEEE | 14.41 | 30576142 | |
292 | N-linked_Glycosylation | KVVDDVSNQTSCRLA EEEECCCCCCCEEEC | 49.34 | UniProtKB CARBOHYD | |
294 | Phosphorylation | VDDVSNQTSCRLAGL EECCCCCCCEEECCC | 33.76 | 30576142 | |
295 | Phosphorylation | DDVSNQTSCRLAGLK ECCCCCCCEEECCCC | 6.36 | 30576142 | |
305 | Phosphorylation | LAGLKPGTVYFVQVR ECCCCCCCEEEEEEE | 22.14 | 22210691 | |
321 | Phosphorylation | NPFGIYGSKKAGIWS CCCCEECCCCCCCCC | 17.63 | 22210691 | |
331 | O-linked_Glycosylation | AGIWSEWSHPTAAST CCCCCCCCCCCCCCC | 18.61 | OGP | |
334 | O-linked_Glycosylation | WSEWSHPTAASTPRS CCCCCCCCCCCCCCC | 29.45 | OGP | |
337 | O-linked_Glycosylation | WSHPTAASTPRSERP CCCCCCCCCCCCCCC | 36.16 | OGP | |
338 | O-linked_Glycosylation | SHPTAASTPRSERPG CCCCCCCCCCCCCCC | 20.28 | OGP | |
368 | Sumoylation | GPVRRELKQFLGWLK CHHHHHHHHHHHHHH | 33.96 | - | |
368 | Sumoylation | GPVRRELKQFLGWLK CHHHHHHHHHHHHHH | 33.96 | - | |
382 | N-linked_Glycosylation | KKHAYCSNLSFRLYD HHHCCCCCCHHHHHH | 35.82 | UniProtKB CARBOHYD | |
384 | Phosphorylation | HAYCSNLSFRLYDQW HCCCCCCHHHHHHHH | 16.75 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CRLF1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CRLF1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CRLF1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CLCF1_HUMAN | CLCF1 | physical | 10966616 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
272430 | Cold-induced sweating syndrome 1 (CISS1) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...