UniProt ID | CLCF1_HUMAN | |
---|---|---|
UniProt AC | Q9UBD9 | |
Protein Name | Cardiotrophin-like cytokine factor 1 | |
Gene Name | CLCF1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 225 | |
Subcellular Localization | Secreted. | |
Protein Description | Cytokine with B-cell stimulating capability. Binds to and activates the ILST/gp130 receptor.. | |
Protein Sequence | MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
29 | N-linked_Glycosylation | LPAVPALNRTGDPGP CCCCCCCCCCCCCCC | 41.39 | UniProtKB CARBOHYD | |
56 | Phosphorylation | YLEHQLRSLAGTYLN HHHHHHHHHHHHHHH | 31.03 | - | |
60 | Phosphorylation | QLRSLAGTYLNYLGP HHHHHHHHHHHHHCC | 21.16 | - | |
96 | Phosphorylation | VDLEVWRSLNDKLRL ECHHHHHHHHHHHHH | 18.80 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CLCF1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CLCF1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLCF1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CLCF1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...