| UniProt ID | IDUA_HUMAN | |
|---|---|---|
| UniProt AC | P35475 | |
| Protein Name | Alpha-L-iduronidase | |
| Gene Name | IDUA | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 653 | |
| Subcellular Localization | Lysosome. | |
| Protein Description | ||
| Protein Sequence | MRPLRPRAALLALLASLLAAPPVAPAEAPHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGPPSPGNP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 110 | N-linked_Glycosylation | TGRGLSYNFTHLDGY CCCCCEEECEEHHHH | 31.78 | 24036510 | |
| 158 | Phosphorylation | EWKDLVSSLARRYIG HHHHHHHHHHHHHHH | 20.69 | 24719451 | |
| 190 | N-linked_Glycosylation | PDHHDFDNVSMTMQG CCCCCCCCCCEEHHH | 27.96 | UniProtKB CARBOHYD | |
| 336 | N-linked_Glycosylation | HQNLLLANTTSAFPY CCCEEECCCCCCCCC | 43.81 | UniProtKB CARBOHYD | |
| 372 | N-linked_Glycosylation | LTARFQVNNTRPPHV EEEEEEECCCCCCCC | 33.11 | 24036510 | |
| 415 | N-linked_Glycosylation | AGTVLDSNHTVGVLA CCCCCCCCCCEEEEE | 34.22 | 24036510 | |
| 451 | N-linked_Glycosylation | DDTRAHPNRSVAVTL CCCCCCCCCEEEEEE | 38.70 | 23959878 | |
| 475 | Phosphorylation | GLVYVTRYLDNGLCS CEEEEEEECCCCCCC | 14.72 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IDUA_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 372 | N | Glycosylation |
| 24036510 |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IDUA_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of IDUA_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 607014 | Mucopolysaccharidosis 1H (MPS1H) | |||||
| 607015 | Mucopolysaccharidosis 1H/S (MPS1H/S) | |||||
| 607016 | Mucopolysaccharidosis 1S (MPS1S) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| N-linked Glycosylation | |
| Reference | PubMed |
| "Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry."; Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.; J. Proteome Res. 8:651-661(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-110, AND MASSSPECTROMETRY. | |