UniProt ID | PTER_HUMAN | |
---|---|---|
UniProt AC | Q96BW5 | |
Protein Name | Phosphotriesterase-related protein | |
Gene Name | PTER | |
Organism | Homo sapiens (Human). | |
Sequence Length | 349 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSSLSGKVQTVLGLVEPSKLGRTLTHEHLAMTFDCCYCPPPPCQEAISKEPIVMKNLYWIQKNAYSHKENLQLNQETEAIKEELLYFKANGGGALVENTTTGISRDTQTLKRLAEETGVHIISGAGFYVDATHSSETRAMSVEQLTDVLMNEILHGADGTSIKCGIIGEIGCSWPLTESERKVLQATAHAQAQLGCPVIIHPGRSSRAPFQIIRILQEAGADISKTVMSHLDRTILDKKELLEFAQLGCYLEYDLFGTELLHYQLGPDIDMPDDNKRIRRVRLLVEEGCEDRILVAHDIHTKTRLMKYGGHGYSHILTNVVPKMLLRGITENVLDKILIENPKQWLTFK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSSLSGKVQ ------CCCCCCHHH | 39.73 | 29759185 | |
3 | Phosphorylation | -----MSSLSGKVQT -----CCCCCCHHHH | 25.84 | 29759185 | |
5 | Phosphorylation | ---MSSLSGKVQTVL ---CCCCCCHHHHHH | 38.22 | 29759185 | |
7 | Ubiquitination | -MSSLSGKVQTVLGL -CCCCCCHHHHHHHH | 28.00 | - | |
10 | Phosphorylation | SLSGKVQTVLGLVEP CCCCHHHHHHHHCCH | 22.23 | 20068231 | |
18 | Phosphorylation | VLGLVEPSKLGRTLT HHHHCCHHHCCCCCC | 27.32 | 20068231 | |
19 | Acetylation | LGLVEPSKLGRTLTH HHHCCHHHCCCCCCH | 66.72 | 25953088 | |
19 | Ubiquitination | LGLVEPSKLGRTLTH HHHCCHHHCCCCCCH | 66.72 | 21906983 | |
19 (in isoform 2) | Ubiquitination | - | 66.72 | - | |
48 | Phosphorylation | PPCQEAISKEPIVMK CCHHHHHCCCCCEEE | 37.71 | - | |
62 | Ubiquitination | KNLYWIQKNAYSHKE EEEHHHHHHCCCCHH | 34.12 | - | |
68 | Ubiquitination | QKNAYSHKENLQLNQ HHHCCCCHHHCCCCH | 42.21 | - | |
81 (in isoform 2) | Ubiquitination | - | 52.78 | - | |
81 | Ubiquitination | NQETEAIKEELLYFK CHHHHHHHHHHHHEE | 52.78 | 21906983 | |
88 | Ubiquitination | KEELLYFKANGGGAL HHHHHHEECCCCCEE | 27.64 | 21906983 | |
111 | Ubiquitination | SRDTQTLKRLAEETG CCCHHHHHHHHHHHC | 49.07 | 21906983 | |
141 | Phosphorylation | SSETRAMSVEQLTDV CCHHHCCCHHHHHHH | 22.86 | - | |
161 | Phosphorylation | LHGADGTSIKCGIIG HHCCCCCEEEECEEC | 26.11 | 30631047 | |
225 | Ubiquitination | EAGADISKTVMSHLD HCCCCHHHHHHHHHC | 45.53 | 21906983 | |
226 | Acetylation | AGADISKTVMSHLDR CCCCHHHHHHHHHCH | 18.04 | 19413330 | |
233 | Methylation | TVMSHLDRTILDKKE HHHHHHCHHCCCHHH | 29.99 | 115489575 | |
238 | Ubiquitination | LDRTILDKKELLEFA HCHHCCCHHHHHHHH | 44.71 | 21906983 | |
292 | Methylation | VEEGCEDRILVAHDI HHCCCCCEEEEEEEC | 11.22 | 115489559 | |
296 (in isoform 2) | Ubiquitination | - | 7.38 | - | |
302 | Ubiquitination | VAHDIHTKTRLMKYG EEEECCCCCCCHHCC | 19.93 | 21906983 | |
313 | Phosphorylation | MKYGGHGYSHILTNV HHCCCCCHHHHHHHH | 7.44 | 29759185 | |
314 | Phosphorylation | KYGGHGYSHILTNVV HCCCCCHHHHHHHHH | 14.51 | - | |
318 | Phosphorylation | HGYSHILTNVVPKML CCHHHHHHHHHHHHH | 25.93 | - | |
327 | Methylation | VVPKMLLRGITENVL HHHHHHHCCCCHHHH | 30.42 | 115489567 | |
330 | Phosphorylation | KMLLRGITENVLDKI HHHHCCCCHHHHHHH | 25.08 | - | |
336 | Ubiquitination | ITENVLDKILIENPK CCHHHHHHHHCCCCC | 34.94 | 21906983 | |
343 | Ubiquitination | KILIENPKQWLTFK- HHHCCCCCCCCCCC- | 66.73 | 21906983 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PTER_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PTER_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PTER_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ABCE1_HUMAN | ABCE1 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...