| UniProt ID | CXL16_HUMAN | |
|---|---|---|
| UniProt AC | Q9H2A7 | |
| Protein Name | C-X-C motif chemokine 16 | |
| Gene Name | CXCL16 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 254 | |
| Subcellular Localization |
Cell membrane Single-pass type I membrane protein . Secreted. Also exists as a soluble form. |
|
| Protein Description | Acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis (By similarity). Induces a strong chemotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo.. | |
| Protein Sequence | MGRDLRPGSRVLLLLLLLLLVYLTQPGNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPVAPDSNT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 45 | Phosphorylation | CYCGKRISSDSPPSV EECCCCCCCCCCCHH | 31.93 | - | |
| 46 | O-linked_Glycosylation | YCGKRISSDSPPSVQ ECCCCCCCCCCCHHH | 39.47 | OGP | |
| 46 | Phosphorylation | YCGKRISSDSPPSVQ ECCCCCCCCCCCHHH | 39.47 | - | |
| 48 | Phosphorylation | GKRISSDSPPSVQFM CCCCCCCCCCHHHHH | 40.43 | - | |
| 95 | Phosphorylation | PWVQELMSCLDLKEC HHHHHHHHHHCHHHH | 24.93 | 22617229 | |
| 107 | O-linked_Glycosylation | KECGHAYSGIVAHQK HHHCCCCCHHHHCHH | 23.87 | OGP | |
| 114 | Phosphorylation | SGIVAHQKHLLPTSP CHHHHCHHHCCCCCC | 26.76 | - | |
| 152 | O-linked_Glycosylation | LQSTQRPTLPVGSLS HHHCCCCCCCCCCCC | 45.97 | OGP | |
| 168 | N-linked_Glycosylation | DKELTRPNETTIHTA CCCCCCCCCCEEECC | 56.83 | UniProtKB CARBOHYD | |
| 178 | O-linked_Glycosylation | TIHTAGHSLAAGPEA EEECCCCHHHCCCCC | 20.84 | OGP | |
| 234 | Phosphorylation | CKRRRGQSPQSSPDL HHHHCCCCCCCCCCC | 27.94 | 28857561 | |
| 237 | Phosphorylation | RRGQSPQSSPDLPVH HCCCCCCCCCCCCCE | 47.42 | 29116813 | |
| 238 | Phosphorylation | RGQSPQSSPDLPVHY CCCCCCCCCCCCCEE | 19.72 | 28857561 | |
| 245 | Phosphorylation | SPDLPVHYIPVAPDS CCCCCCEEEECCCCC | 13.73 | 28857561 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CXL16_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CXL16_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CXL16_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| KASH5_HUMAN | CCDC155 | physical | 25416956 | |
| KR107_HUMAN | KRTAP10-7 | physical | 25416956 | |
| KR109_HUMAN | KRTAP10-9 | physical | 25416956 | |
| KR101_HUMAN | KRTAP10-1 | physical | 25416956 | |
| KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
| NT2NL_HUMAN | NOTCH2NL | physical | 25416956 | |
| TM239_HUMAN | TMEM239 | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
