REG3A_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: REG3A_HUMAN
• UniProt AC: Q06141
• Protein Name: Regenerating islet-derived protein 3-alpha
• Gene Name: REG3A
• Organism: Homo sapiens (Human).
• Sequence Length: 175
• Subcellular Localization: Secreted. Found in the apical region of pancreatic acinar cells.
• Protein Description: Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway..
• Protein Sequence: MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
78	Phosphorylation	RPSGNLVSVLSGAEG CCCCCEEEEECCCCC	22.10	28122231
81	Phosphorylation	GNLVSVLSGAEGSFV CCEEEEECCCCCHHH	33.53	28122231
86	Phosphorylation	VLSGAEGSFVSSLVK EECCCCCHHHHHHHH	17.61	28122231
89	Phosphorylation	GAEGSFVSSLVKSIG CCCCHHHHHHHHHHC	18.88	28122231
90	Phosphorylation	AEGSFVSSLVKSIGN CCCHHHHHHHHHHCC	31.70	28122231
148	Phosphorylation	SSPGHCASLSRSTAF CCCCHHHHCCCCCEE	32.07	27174698
150	Phosphorylation	PGHCASLSRSTAFLR CCHHHHCCCCCEEEE	22.99	27174698

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of REG3A_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of REG3A_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of REG3A_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SDC2_HUMAN	SDC2	physical	8997243
FINC_HUMAN	FN1	physical	8997243
ACTB_HUMAN	ACTB	physical	28514442
ACTA_HUMAN	ACTA2	physical	28514442
ACTBL_HUMAN	ACTBL2	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.