| UniProt ID | DCNP1_HUMAN | |
|---|---|---|
| UniProt AC | Q8TF63 | |
| Protein Name | Dendritic cell nuclear protein 1 {ECO:0000303|PubMed:11798177} | |
| Gene Name | DCANP1 {ECO:0000312|HGNC:HGNC:24459} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 244 | |
| Subcellular Localization | Nucleus . Cytoplasm . Particularly on the periphery. Colocalizes with corticotropin-releasing hormone (CRH) in parvocellular neurons in the paraventricular nucleus. | |
| Protein Description | Binds with and transactivates the corticotropin-releasing hormone (CRH) promoter.. | |
| Protein Sequence | MHYGAATHIQNSRSHGLETVPGHQRLERGAGGETPEFPGCHSPAPPENFGNELLPLSAPLQGLSEGLYPPGRNKTLPAGVLREGAVQFLHRGLCNSNLSSEASARPSGTQDELHSSRRKTGQTRREGARKHLVCSFRLYPFTVHTVSPGNSHLALYQVFKAVKLCPSETSFFLSRKSLKSSDPWHPPSLSPNSWNRQAGFRAWSSHLISLSLTCSDSQSRRVSSSQQPPLHSLSSHRRAAHVPE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 100 | Phosphorylation | LCNSNLSSEASARPS CCCCCCCHHHHCCCC | 40.11 | 30576142 | |
| 107 | Phosphorylation | SEASARPSGTQDELH HHHHCCCCCCHHHHH | 49.25 | 30576142 | |
| 115 | Phosphorylation | GTQDELHSSRRKTGQ CCHHHHHHHHHHHCC | 37.86 | 30576142 | |
| 139 | Phosphorylation | LVCSFRLYPFTVHTV EEEEEEEEEEEEEEC | 7.64 | - | |
| 142 | Phosphorylation | SFRLYPFTVHTVSPG EEEEEEEEEEECCCC | 13.58 | - | |
| 167 | Phosphorylation | KAVKLCPSETSFFLS HHHHCCCCCCEEEEC | 53.13 | 25850435 | |
| 169 | Phosphorylation | VKLCPSETSFFLSRK HHCCCCCCEEEECCC | 34.86 | 21955146 | |
| 170 | Phosphorylation | KLCPSETSFFLSRKS HCCCCCCEEEECCCC | 15.22 | 21955146 | |
| 174 | Phosphorylation | SETSFFLSRKSLKSS CCCEEEECCCCCCCC | 32.29 | 21955146 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DCNP1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DCNP1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DCNP1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of DCNP1_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...