dbPTM

CV039_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CV039_HUMAN
UniProt AC	Q6P5X5
Protein Name	UPF0545 protein C22orf39
Gene Name	C22orf39
Organism	Homo sapiens (Human).
Sequence Length	142
Subcellular Localization
Protein Description
Protein Sequence	MCRCSLVLLSVDHEVPFSSFFIGWRTEGRAWRAGRPDMADGSGWQPPRPCEAYRAEWKLCRSARHFLHHYYVHGERPACEQWQRDLASCRDWEERRNAEAQQSLCESERARVRAARKHILVWAPRQSPPPDWHLPLPQEKDE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
18	Phosphorylation	VDHEVPFSSFFIGWR CCCCCCCHHHCCEEE	17.83	24719451
19	Phosphorylation	DHEVPFSSFFIGWRT CCCCCCHHHCCEEEE	35.82	24719451
117	Acetylation	ARVRAARKHILVWAP HHHHHHHHHEEEECC		18586695

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CV039_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CV039_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CV039_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
KR103_HUMAN	KRTAP10-3	physical	25416956
CEP76_HUMAN	CEP76	physical	21516116

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CV039_HUMAN

Related Literatures of Post-Translational Modification