MYF5_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MYF5_HUMAN
• UniProt AC: P13349
• Protein Name: Myogenic factor 5
• Gene Name: MYF5
• Organism: Homo sapiens (Human).
• Sequence Length: 255
• Subcellular Localization: Nucleus.
• Protein Description: Acts as a transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation. Together with MYOG and MYOD1, co-occupies muscle-specific gene promoter core region during myogenesis. Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein..
• Protein Sequence: MDVMDGCQFSPSEYFYDGSCIPSPEGEFGDEFVPRVAAFGAHKAELQGSDEDEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKSSTFDSIYCPDVSNVYATDKNSLSSLDCLSNIVDRITSSEQPGLPLQDLASLSPVASTDSQPATPGASSSRLIYHVL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
49	Phosphorylation	HKAELQGSDEDEHVR CHHHHCCCCCCCCCC	25.51	22817900
79	Phosphorylation	CKACKRKSTTMDRRK HHHHCCCCCHHHHHH	32.89	25999147
80	Phosphorylation	KACKRKSTTMDRRKA HHHCCCCCHHHHHHH	29.22	25999147
81	Phosphorylation	ACKRKSTTMDRRKAA HHCCCCCHHHHHHHH	24.94	28634120
89	Phosphorylation	MDRRKAATMRERRRL HHHHHHHHHHHHHHH	22.94	22817900
105	Phosphorylation	KVNQAFETLKRCTTT HHHHHHHHHHHHCCC	31.00	23607784
133	Phosphorylation	NAIRYIESLQELLRE HHHHHHHHHHHHHHH	26.29	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
49	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
49	S	Phosphorylation	Kinase	CK2-FAMILY	-	GPS
49	S	Phosphorylation	Kinase	CK2_GROUP	-	PhosphoELM
133	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
133	S	Phosphorylation	Kinase	CK2-FAMILY	-	GPS
133	S	Phosphorylation	Kinase	CK2_GROUP	-	PhosphoELM
-	K	Ubiquitination	E3 ubiquitin ligase	FZR1	Q9UM11	PMID:17601983

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MYF5_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MYF5_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TFE2_HUMAN	TCF3	physical	2385294

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.