K0040_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: K0040_HUMAN
• UniProt AC: Q15053
• Protein Name: Uncharacterized protein KIAA0040
• Gene Name: KIAA0040
• Organism: Homo sapiens (Human).
• Sequence Length: 153
• Protein Sequence: MHYVHVHRVTTQPRNKPQTKCPSGGQSQGPRGQFLDTVLAAMCPIAMLLTADPGMPPTCLWHTPHAKHKEHLSIHLNMVPKCVHMHVTHTHTNSGSRYVGKYILLIKWSLAMYFVQGSTLSTVTKMSHGKALPDSDTYIQFPNQQGPHTPSIP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MHYVHVHRVT -----CCEEEEEEEE	7.31	23663014
10	Phosphorylation	YVHVHRVTTQPRNKP EEEEEEEECCCCCCC	21.48	23663014
11	Phosphorylation	VHVHRVTTQPRNKPQ EEEEEEECCCCCCCC	33.45	23663014
96	Phosphorylation	HTHTNSGSRYVGKYI EECCCCCCCCCEEEE	21.91	24719451
96	Phosphorylation	HTHTNSGSRYVGKYI EECCCCCCCCCEEEE	21.91	29978859

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of K0040_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of K0040_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of K0040_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KR103_HUMAN	KRTAP10-3	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.