| UniProt ID | TM241_HUMAN | |
|---|---|---|
| UniProt AC | Q24JQ0 | |
| Protein Name | Transmembrane protein 241 | |
| Gene Name | TMEM241 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 296 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MCVRRSLVGLTFCTCYLASYLTNKYVLSVLKFTYPTLFQGWQTLIGGLLLHVSWKLGWVEINSSSRSHVLVWLPASVLFVGIIYAGSRALSRLAIPVFLTLHNVAEVIICGYQKCFQKEKTSPAKICSALLLLAAAGCLPFNDSQFNPDGYFWAIIHLLCVGAYKILQKSQKPSALSDIDQQYLNYIFSVVLLAFASHPTGDLFSVLDFPFLYFYRFHGSCCASGFLGFFLMFSTVKLKNLLAPGQCAAWIFFAKIITAGLSILLFDAILTSATTGCLLLGALGEALLVFSERKSS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 25 | Phosphorylation | ASYLTNKYVLSVLKF HHHHCCHHHHHHHHH | 14.53 | - | |
| 28 | Phosphorylation | LTNKYVLSVLKFTYP HCCHHHHHHHHHCHH | 18.50 | - | |
| 33 | Phosphorylation | VLSVLKFTYPTLFQG HHHHHHHCHHHHHCH | 27.31 | 18452278 | |
| 34 | Phosphorylation | LSVLKFTYPTLFQGW HHHHHHCHHHHHCHH | 9.43 | 18452278 | |
| 36 | Phosphorylation | VLKFTYPTLFQGWQT HHHHCHHHHHCHHHH | 29.77 | 18452278 | |
| 63 | Phosphorylation | LGWVEINSSSRSHVL CCCEEECCCCCCEEE | 35.04 | - | |
| 224 | Phosphorylation | FHGSCCASGFLGFFL CCCCHHHHHHHHHHH | 19.03 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM241_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM241_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM241_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| K1C40_HUMAN | KRT40 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...