UniProt ID | TM241_HUMAN | |
---|---|---|
UniProt AC | Q24JQ0 | |
Protein Name | Transmembrane protein 241 | |
Gene Name | TMEM241 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 296 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MCVRRSLVGLTFCTCYLASYLTNKYVLSVLKFTYPTLFQGWQTLIGGLLLHVSWKLGWVEINSSSRSHVLVWLPASVLFVGIIYAGSRALSRLAIPVFLTLHNVAEVIICGYQKCFQKEKTSPAKICSALLLLAAAGCLPFNDSQFNPDGYFWAIIHLLCVGAYKILQKSQKPSALSDIDQQYLNYIFSVVLLAFASHPTGDLFSVLDFPFLYFYRFHGSCCASGFLGFFLMFSTVKLKNLLAPGQCAAWIFFAKIITAGLSILLFDAILTSATTGCLLLGALGEALLVFSERKSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
25 | Phosphorylation | ASYLTNKYVLSVLKF HHHHCCHHHHHHHHH | 14.53 | - | |
28 | Phosphorylation | LTNKYVLSVLKFTYP HCCHHHHHHHHHCHH | 18.50 | - | |
33 | Phosphorylation | VLSVLKFTYPTLFQG HHHHHHHCHHHHHCH | 27.31 | 18452278 | |
34 | Phosphorylation | LSVLKFTYPTLFQGW HHHHHHCHHHHHCHH | 9.43 | 18452278 | |
36 | Phosphorylation | VLKFTYPTLFQGWQT HHHHCHHHHHCHHHH | 29.77 | 18452278 | |
63 | Phosphorylation | LGWVEINSSSRSHVL CCCEEECCCCCCEEE | 35.04 | - | |
224 | Phosphorylation | FHGSCCASGFLGFFL CCCCHHHHHHHHHHH | 19.03 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM241_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM241_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM241_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
K1C40_HUMAN | KRT40 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...