S35A2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: S35A2_HUMAN
• UniProt AC: P78381
• Protein Name: UDP-galactose translocator
• Gene Name: SLC35A2
• Organism: Homo sapiens (Human).
• Sequence Length: 396
• Subcellular Localization: Golgi apparatus membrane; Multi-pass membrane protein.
• Protein Description: Transports nucleotide sugars from the cytosol into Golgi vesicles where glycosyltransferases function..
• Protein Sequence: MAAVGAGGSTAAPGPGAVSAGALEPGTASAAHRRLKYISLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGGGPRPLDQNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVATRGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHVDPLFALGAGLVIGAVYLYSLPRGAAKAIASASASASGPCVHQQPPGQPPPPQLSSHRGDLITEPFLPKLLTKVKGS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
9	Phosphorylation	AAVGAGGSTAAPGPG CCCCCCCCCCCCCCC	17.60	28857561
10	Phosphorylation	AVGAGGSTAAPGPGA CCCCCCCCCCCCCCC	30.07	28857561
19	Phosphorylation	APGPGAVSAGALEPG CCCCCCCCCCCCCCC	22.05	28857561
27	Phosphorylation	AGALEPGTASAAHRR CCCCCCCCCCHHHHH	28.31	28857561
29	Phosphorylation	ALEPGTASAAHRRLK CCCCCCCCHHHHHHH	26.31	28857561
227	Phosphorylation	FEKILKGSSGSVWLR HHHHHHCCCCCCHHH	29.91	22817900
228	Phosphorylation	EKILKGSSGSVWLRN HHHHHCCCCCCHHHH	43.70	22817900
256	Phosphorylation	GLWWAEGTAVATRGF HHHHHHCCEEEECCC	14.95	22210691
260	Phosphorylation	AEGTAVATRGFFFGY HHCCEEEECCCCCCC	25.40	22210691
301	Phosphorylation	NILKGFATSLSIVLS HHHHHHHHHHHHHHH	28.12	25262027
302	Phosphorylation	ILKGFATSLSIVLST HHHHHHHHHHHHHHH	19.38	28857561
304	Phosphorylation	KGFATSLSIVLSTVA HHHHHHHHHHHHHHH	15.49	25262027
308	Phosphorylation	TSLSIVLSTVASIRL HHHHHHHHHHHHHHH	15.22	25262027
309	Phosphorylation	SLSIVLSTVASIRLF HHHHHHHHHHHHHHH	18.87	25262027
312	Phosphorylation	IVLSTVASIRLFGFH HHHHHHHHHHHHCCC	12.14	25262027
350	Phosphorylation	GAAKAIASASASASG HHHHHHHHHHHCCCC	19.35	28348404
352	Phosphorylation	AKAIASASASASGPC HHHHHHHHHCCCCCC	21.91	28348404
354	Phosphorylation	AIASASASASGPCVH HHHHHHHCCCCCCCC	22.07	28348404
356	Phosphorylation	ASASASASGPCVHQQ HHHHHCCCCCCCCCC	40.55	28348404

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of S35A2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of S35A2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of S35A2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KR103_HUMAN	KRTAP10-3	physical	25416956
TRY2_HUMAN	PRSS2	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 300896: Congenital disorder of glycosylation 2M (CDG2M)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column.";
Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y.;
Anal. Sci. 24:161-166(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-227 AND SER-228, ANDMASS SPECTROMETRY.
PubMed: 18187866