UniProt ID | AVPI1_HUMAN | |
---|---|---|
UniProt AC | Q5T686 | |
Protein Name | Arginine vasopressin-induced protein 1 | |
Gene Name | AVPI1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 147 | |
Subcellular Localization | ||
Protein Description | May be involved in MAP kinase activation, epithelial sodium channel (ENaC) down-regulation and cell cycling.. | |
Protein Sequence | MGTPASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQALFQRSGDQLAEERAQIIWECAGDHRVAEALKRLRRKRPPRQKPLGHSLHHCSRLRILEPHSALANPQSATETASSEQYLHSRKKSARIRRNWRKSGPTSYLHQIRH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
136 | Phosphorylation | IRRNWRKSGPTSYLH HHHHHHHHCCCCHHC | 41.24 | 25159151 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AVPI1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AVPI1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AVPI1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
K1C40_HUMAN | KRT40 | physical | 25416956 | |
KR122_HUMAN | KRTAP12-2 | physical | 25416956 | |
KR107_HUMAN | KRTAP10-7 | physical | 25416956 | |
KR109_HUMAN | KRTAP10-9 | physical | 25416956 | |
KR101_HUMAN | KRTAP10-1 | physical | 25416956 | |
KR103_HUMAN | KRTAP10-3 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...