AVPI1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AVPI1_HUMAN
• UniProt AC: Q5T686
• Protein Name: Arginine vasopressin-induced protein 1
• Gene Name: AVPI1
• Organism: Homo sapiens (Human).
• Sequence Length: 147
• Protein Description: May be involved in MAP kinase activation, epithelial sodium channel (ENaC) down-regulation and cell cycling..
• Protein Sequence: MGTPASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQALFQRSGDQLAEERAQIIWECAGDHRVAEALKRLRRKRPPRQKPLGHSLHHCSRLRILEPHSALANPQSATETASSEQYLHSRKKSARIRRNWRKSGPTSYLHQIRH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
136	Phosphorylation	IRRNWRKSGPTSYLH HHHHHHHHCCCCHHC	41.24	25159151

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AVPI1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AVPI1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AVPI1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
K1C40_HUMAN	KRT40	physical	25416956
KR122_HUMAN	KRTAP12-2	physical	25416956
KR107_HUMAN	KRTAP10-7	physical	25416956
KR109_HUMAN	KRTAP10-9	physical	25416956
KR101_HUMAN	KRTAP10-1	physical	25416956
KR103_HUMAN	KRTAP10-3	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.