PIHD2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PIHD2_HUMAN
• UniProt AC: Q8WWB5
• Protein Name: PIH1 domain-containing protein 2
• Gene Name: PIH1D2
• Organism: Homo sapiens (Human).
• Sequence Length: 315
• Protein Sequence: METSSKGLLTQVTQFWNLLDDLAQSDPEGYEKFIQQQLKEGKQLCAAPEPQLCLQTRILKPKEKILFINLCQWTRIPAPQSTTHPVPLTVGKPEDTTEISDAYTVIDVAYNPDVLHAAEKDQVKKNQLIQMAMKCIEEKFQFTLSHSYHITKFRIKGSIQRMKQNLMGIQTDSIDLREKMRRELTLGQIRSSTMSNPDHFPQLLLPKDQVSGKAVCLIEEISSTEIQVEMKMPAYELKIVHDHSEKPLKIELKVELPGINSVSLCDLSVSEDDLLIEVSEKYRLHLNLPKLIDTEMTTAKFIKEKSTLIITMPLV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
173	Phosphorylation	LMGIQTDSIDLREKM HHCCCCCCHHHHHHH	22.76	26546556
263 (in isoform 2)	Phosphorylation	-	24.09	22210691
273 (in isoform 2)	Phosphorylation	-	39.05	22210691
285 (in isoform 2)	Phosphorylation	-	12.04	22210691

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PIHD2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PIHD2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PIHD2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PIHD2_HUMAN	PIH1D2	physical	25416956
DPH3_HUMAN	DPH3	physical	25416956
KR124_HUMAN	KRTAP12-4	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.