UniProt ID | PIHD2_HUMAN | |
---|---|---|
UniProt AC | Q8WWB5 | |
Protein Name | PIH1 domain-containing protein 2 | |
Gene Name | PIH1D2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 315 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | METSSKGLLTQVTQFWNLLDDLAQSDPEGYEKFIQQQLKEGKQLCAAPEPQLCLQTRILKPKEKILFINLCQWTRIPAPQSTTHPVPLTVGKPEDTTEISDAYTVIDVAYNPDVLHAAEKDQVKKNQLIQMAMKCIEEKFQFTLSHSYHITKFRIKGSIQRMKQNLMGIQTDSIDLREKMRRELTLGQIRSSTMSNPDHFPQLLLPKDQVSGKAVCLIEEISSTEIQVEMKMPAYELKIVHDHSEKPLKIELKVELPGINSVSLCDLSVSEDDLLIEVSEKYRLHLNLPKLIDTEMTTAKFIKEKSTLIITMPLV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
173 | Phosphorylation | LMGIQTDSIDLREKM HHCCCCCCHHHHHHH | 22.76 | 26546556 | |
263 (in isoform 2) | Phosphorylation | - | 24.09 | 22210691 | |
273 (in isoform 2) | Phosphorylation | - | 39.05 | 22210691 | |
285 (in isoform 2) | Phosphorylation | - | 12.04 | 22210691 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PIHD2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PIHD2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PIHD2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PIHD2_HUMAN | PIH1D2 | physical | 25416956 | |
DPH3_HUMAN | DPH3 | physical | 25416956 | |
KR124_HUMAN | KRTAP12-4 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...