DPH3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DPH3_HUMAN
• UniProt AC: Q96FX2
• Protein Name: DPH3 homolog
• Gene Name: DPH3
• Organism: Homo sapiens (Human).
• Sequence Length: 82
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Essential for the first step in the synthesis of diphthamide, a post-translational modification of histidine which occurs in elongation factor 2 (EEF2) and which can be ADP-ribosylated by diphtheria toxin and by Pseudomonas exotoxin A (Eta).; Down-regulation increases extracellular release of proteoglycans, indicating a possible role in the secretion process. Stimulates binding of GNEFR to SEC5..
• Protein Sequence: MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVKC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of DPH3_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DPH3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DPH3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DPH3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RL8_HUMAN	RPL8	physical	21988832
SRGEF_HUMAN	SERGEF	physical	28514442
DPH2_HUMAN	DPH2	physical	28514442
ATE1_HUMAN	ATE1	physical	28514442
NEK7_HUMAN	NEK7	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.