ATG12_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ATG12_HUMAN
• UniProt AC: O94817
• Protein Name: Ubiquitin-like protein ATG12
• Gene Name: ATG12
• Organism: Homo sapiens (Human).
• Sequence Length: 140
• Subcellular Localization: Cytoplasm. Preautophagosomal structure membrane ; Peripheral membrane protein . TECPR1 recruits the ATG12-ATG5 conjugate to the autolysosomal membrane.
• Protein Description: Ubiquitin-like protein involved in autophagy vesicles formation. Conjugation with ATG5 through a ubiquitin-like conjugating system involving also ATG7 as an E1-like activating enzyme and ATG10 as an E2-like conjugating enzyme, is essential for its function. The ATG12-ATG5 conjugate acts as an E3-like enzyme which is required for lipidation of ATG8 family proteins and their association to the vesicle membranes.; (Microbial infection) May act as a proviral factor. In association with ATG5, negatively regulates the innate antiviral immune response by impairing the type I IFN production pathway upon vesicular stomatitis virus (VSV) infection. [PubMed: 17709747 Required for the translation of incoming hepatitis C virus (HCV) RNA and, thereby, for the initiation of HCV replication, but not required once infection is established]
• Protein Sequence: MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MAEEPQSVLQLPTS -CCCCCCHHHHCCCC	35.19	22468782
13	Phosphorylation	QSVLQLPTSIAAGGE CHHHHCCCCCCCCCC	41.16	28348404
14	Phosphorylation	SVLQLPTSIAAGGEG HHHHCCCCCCCCCCC	14.32	28348404
23	Phosphorylation	AAGGEGLTDVSPETT CCCCCCCCCCCCCCC	45.25	22468782
26	Phosphorylation	GEGLTDVSPETTTPE CCCCCCCCCCCCCCC	21.59	22468782
29	Phosphorylation	LTDVSPETTTPEPPS CCCCCCCCCCCCCCC	39.08	28348404
30	Phosphorylation	TDVSPETTTPEPPSS CCCCCCCCCCCCCCC	38.40	28348404
31	Phosphorylation	DVSPETTTPEPPSSA CCCCCCCCCCCCCCC	32.83	28348404
41	Phosphorylation	PPSSAAVSPGTEEPA CCCCCCCCCCCCCCC	16.94	28348404
60	Ubiquitination	KKIDILLKAVGDTPI HHHHHHHHHHCCCCC	37.27	22817900
65	Phosphorylation	LLKAVGDTPIMKTKK HHHHHCCCCCCCCCC	14.58	-
69	Ubiquitination	VGDTPIMKTKKWAVE HCCCCCCCCCCHHHH	58.89	27667366
69	Malonylation	VGDTPIMKTKKWAVE HCCCCCCCCCCHHHH	58.89	26320211
70	Phosphorylation	GDTPIMKTKKWAVER CCCCCCCCCCHHHHH	22.07	-
71	Ubiquitination	DTPIMKTKKWAVERT CCCCCCCCCHHHHHH	40.58	22817900
72	Ubiquitination	TPIMKTKKWAVERTR CCCCCCCCHHHHHHH	45.69	22817900
89	Ubiquitination	QGLIDFIKKFLKLVA HHHHHHHHHHHHHHH	37.15	22817900
90	Ubiquitination	GLIDFIKKFLKLVAS HHHHHHHHHHHHHHH	51.63	22817900
93	Ubiquitination	DFIKKFLKLVASEQL HHHHHHHHHHHHCCE	44.01	22817900
107 (in isoform 1)	Ubiquitination	-	20.40	21906983
116 (in isoform 1)	Ubiquitination	-	6.20	21906983
136 (in isoform 1)	Ubiquitination	-	22.90	21906983

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ATG12_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ATG12_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ATG12_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KR412_HUMAN	KRTAP4-12	physical	16189514
DHX36_HUMAN	DHX36	physical	17353931
OTUD4_HUMAN	OTUD4	physical	17353931
ATG5_HUMAN	ATG5	physical	17353931
ATG10_HUMAN	ATG10	physical	17353931
AUP1_HUMAN	AUP1	physical	17353931
SF3A1_HUMAN	SF3A1	physical	17353931
A16L1_HUMAN	ATG16L1	physical	17353931
SF3B1_HUMAN	SF3B1	physical	17353931
TCPR1_HUMAN	TECPR1	physical	20562859
ATG4B_HUMAN	ATG4B	physical	20562859
A16L1_HUMAN	ATG16L1	physical	20562859
MAP1B_HUMAN	MAP1B	physical	20562859
ATG5_HUMAN	ATG5	physical	20562859
ATG7_HUMAN	ATG7	physical	20562859
ATG3_HUMAN	ATG3	physical	20562859
GBRAP_HUMAN	GABARAP	physical	20562859
ATG3_HUMAN	ATG3	physical	20723759
MCL1_HUMAN	MCL1	physical	22152474
BCL2_HUMAN	BCL2	physical	22152474
A4_HUMAN	APP	physical	21832049
ATG10_MOUSE	Atg10	physical	12890687
CAV1_HUMAN	CAV1	physical	24727585
ATG3_MOUSE	Atg3	physical	23202584

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.