UniProt ID | ATG10_HUMAN | |
---|---|---|
UniProt AC | Q9H0Y0 | |
Protein Name | Ubiquitin-like-conjugating enzyme ATG10 | |
Gene Name | ATG10 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 220 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | E2-like enzyme involved in autophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for autophagy. Likely serves as an ATG5-recognition molecule. Not involved in ATG12 conjugation to ATG3 (By similarity). Plays a role in adenovirus-mediated cell lysis.. | |
Protein Sequence | MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Ubiquitination | EDEFIGEKTFQRYCA CCCCCCHHHHHHHHH | 49.80 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATG10_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATG10_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATG10_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ATG7_HUMAN | ATG7 | physical | 20562859 | |
KRT85_HUMAN | KRT85 | physical | 20562859 | |
MAP1B_HUMAN | MAP1B | physical | 20562859 | |
UBP11_HUMAN | USP11 | physical | 20562859 | |
ATG4B_HUMAN | ATG4B | physical | 20562859 | |
ATG3_HUMAN | ATG3 | physical | 20562859 | |
UBP7_HUMAN | USP7 | physical | 20562859 | |
HAT1_HUMAN | HAT1 | physical | 20562859 | |
RBBP7_HUMAN | RBBP7 | physical | 20562859 | |
PURA2_HUMAN | ADSS | physical | 20562859 | |
ATG12_HUMAN | ATG12 | physical | 26186194 | |
ATG7_HUMAN | ATG7 | physical | 26186194 | |
ATG12_HUMAN | ATG12 | physical | 28514442 | |
ATG7_HUMAN | ATG7 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...