| UniProt ID | ATG10_HUMAN | |
|---|---|---|
| UniProt AC | Q9H0Y0 | |
| Protein Name | Ubiquitin-like-conjugating enzyme ATG10 | |
| Gene Name | ATG10 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 220 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | E2-like enzyme involved in autophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for autophagy. Likely serves as an ATG5-recognition molecule. Not involved in ATG12 conjugation to ATG3 (By similarity). Plays a role in adenovirus-mediated cell lysis.. | |
| Protein Sequence | MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Ubiquitination | EDEFIGEKTFQRYCA CCCCCCHHHHHHHHH | 49.80 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATG10_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATG10_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATG10_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ATG7_HUMAN | ATG7 | physical | 20562859 | |
| KRT85_HUMAN | KRT85 | physical | 20562859 | |
| MAP1B_HUMAN | MAP1B | physical | 20562859 | |
| UBP11_HUMAN | USP11 | physical | 20562859 | |
| ATG4B_HUMAN | ATG4B | physical | 20562859 | |
| ATG3_HUMAN | ATG3 | physical | 20562859 | |
| UBP7_HUMAN | USP7 | physical | 20562859 | |
| HAT1_HUMAN | HAT1 | physical | 20562859 | |
| RBBP7_HUMAN | RBBP7 | physical | 20562859 | |
| PURA2_HUMAN | ADSS | physical | 20562859 | |
| ATG12_HUMAN | ATG12 | physical | 26186194 | |
| ATG7_HUMAN | ATG7 | physical | 26186194 | |
| ATG12_HUMAN | ATG12 | physical | 28514442 | |
| ATG7_HUMAN | ATG7 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
