UniProt ID | ATG10_MOUSE | |
---|---|---|
UniProt AC | Q8R1P4 | |
Protein Name | Ubiquitin-like-conjugating enzyme ATG10 | |
Gene Name | Atg10 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 215 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | E2-like enzyme involved in autophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for autophagy. Likely serves as an ATG5-recognition molecule. Not involved in ATG12 conjugation to ATG3. Plays a role in adenovirus-mediated cell lysis.. | |
Protein Sequence | MEDEFFGEKSFQHYCAEFIRHSQQIGDGWEWRTAKECSDGYMCKTQFRIKNEASTPHVGTPASVLTCLPTEENLELPMDDSEVTRPAAVAEVIKHEYHVLYSCSYQVPVLYFRASFLDGRPLALEDIWEGVHECYKPRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTAVLKNSQKINRNVNYITSWLSLVGPVVGLNLPLSYAKATSQSE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
44 | Ubiquitination | CSDGYMCKTQFRIKN CCCCEEEEEEEEECC | 28.91 | 22790023 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATG10_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATG10_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATG10_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MLP3B_MOUSE | Map1lc3b | physical | 12890687 | |
ATG12_HUMAN | ATG12 | physical | 12890687 | |
ATG7_HUMAN | ATG7 | physical | 12890687 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...