ATG10_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ATG10_MOUSE
• UniProt AC: Q8R1P4
• Protein Name: Ubiquitin-like-conjugating enzyme ATG10
• Gene Name: Atg10
• Organism: Mus musculus (Mouse).
• Sequence Length: 215
• Subcellular Localization: Cytoplasm .
• Protein Description: E2-like enzyme involved in autophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for autophagy. Likely serves as an ATG5-recognition molecule. Not involved in ATG12 conjugation to ATG3. Plays a role in adenovirus-mediated cell lysis..
• Protein Sequence: MEDEFFGEKSFQHYCAEFIRHSQQIGDGWEWRTAKECSDGYMCKTQFRIKNEASTPHVGTPASVLTCLPTEENLELPMDDSEVTRPAAVAEVIKHEYHVLYSCSYQVPVLYFRASFLDGRPLALEDIWEGVHECYKPRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTAVLKNSQKINRNVNYITSWLSLVGPVVGLNLPLSYAKATSQSE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
44	Ubiquitination	CSDGYMCKTQFRIKN CCCCEEEEEEEEECC	28.91	22790023

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ATG10_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ATG10_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ATG10_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MLP3B_MOUSE	Map1lc3b	physical	12890687
ATG12_HUMAN	ATG12	physical	12890687
ATG7_HUMAN	ATG7	physical	12890687

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.