| UniProt ID | GBRAP_HUMAN | |
|---|---|---|
| UniProt AC | O95166 | |
| Protein Name | Gamma-aminobutyric acid receptor-associated protein | |
| Gene Name | GABARAP | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 117 | |
| Subcellular Localization | Endomembrane system. Cytoplasm, cytoskeleton . Golgi apparatus membrane. Cytoplasmic vesicle, autophagosome . Cytoplasmic vesicle . Largely associated with intracellular membrane structures including the Golgi apparatus and postsynaptic cisternae. Co | |
| Protein Description | Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in apoptosis. Involved in autophagy. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.. | |
| Protein Sequence | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Ubiquitination | --MKFVYKEEHPFEK --CCCCCCCCCCCHH | 51.85 | - | |
| 13 | Ubiquitination | KEEHPFEKRRSEGEK CCCCCCHHCCCHHHH | 54.19 | - | |
| 13 | 2-Hydroxyisobutyrylation | KEEHPFEKRRSEGEK CCCCCCHHCCCHHHH | 54.19 | - | |
| 23 | Ubiquitination | SEGEKIRKKYPDRVP CHHHHHHHHCCCCCC | 61.20 | - | |
| 24 | Ubiquitination | EGEKIRKKYPDRVPV HHHHHHHHCCCCCCE | 52.76 | 2189047 | |
| 28 | Methylation | IRKKYPDRVPVIVEK HHHHCCCCCCEEEEE | 30.09 | - | |
| 35 | Acetylation | RVPVIVEKAPKARIG CCCEEEEECCCCCCC | 60.12 | 130599 | |
| 35 | Ubiquitination | RVPVIVEKAPKARIG CCCEEEEECCCCCCC | 60.12 | - | |
| 49 | Phosphorylation | GDLDKKKYLVPSDLT CCCCCCCEECCCCCC | 23.08 | - | |
| 56 | Phosphorylation | YLVPSDLTVGQFYFL EECCCCCCHHHHHHH | 27.81 | - | |
| 61 | Phosphorylation | DLTVGQFYFLIRKRI CCCHHHHHHHHHCHH | 6.92 | - | |
| 116 | Phosphatidylethanolamine amidation | YSDESVYGL------ ECCCCCCCC------ | 23.82 | 12507496 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GBRAP_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GBRAP_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GBRAP_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
