UniProt ID | ATGA1_HUMAN | |
---|---|---|
UniProt AC | Q9BSB4 | |
Protein Name | Autophagy-related protein 101 | |
Gene Name | ATG101 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 218 | |
Subcellular Localization |
Cytoplasm . Preautophagosomal structure . Under starvation conditions, it is localized to puncate structures primarily representing the isolation membrane the isolation membrane sequesters a portion of the cytoplasm resulting in autophagosome format |
|
Protein Description | Autophagy factor required for autophagosome formation. Stabilizes ATG13, protecting it from proteasomal degradation.. | |
Protein Sequence | MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFIDFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | RSEVLEVSVEGRQVE CCEEEEEEECCHHHH | 12.69 | 22985185 | |
78 | Ubiquitination | ELDRALRKVVGEFKD HHHHHHHHHHHHHHH | 41.96 | - | |
84 | Acetylation | RKVVGEFKDALRNSG HHHHHHHHHHHHHCC | 37.48 | 132905 | |
84 | Ubiquitination | RKVVGEFKDALRNSG HHHHHHHHHHHHHCC | 37.48 | - | |
105 | Ubiquitination | MSLEFYQKKKSRWPF CHHHHHHHHHCCCCC | 51.28 | 21906983 | |
106 | Ubiquitination | SLEFYQKKKSRWPFS HHHHHHHHHCCCCCC | 40.22 | - | |
151 | Ubiquitination | VGEKLCEKIINIVEV HHHHHHHHHHHHHHH | 48.14 | - | |
164 | Phosphorylation | EVMNRHEYLPKMPTQ HHHCCCCCCCCCCCH | 23.37 | 25884760 | |
167 | Ubiquitination | NRHEYLPKMPTQSEV CCCCCCCCCCCHHHH | 55.72 | - | |
203 | Phosphorylation | ITDALGTSVTTTMRR EECCCCCCHHHHHHH | 18.70 | - | |
213 | Ubiquitination | TTMRRLIKDTLAL-- HHHHHHHHHHHCC-- | 49.61 | - |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATGA1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATGA1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...