UniProt ID | ZN707_HUMAN | |
---|---|---|
UniProt AC | Q96C28 | |
Protein Name | Zinc finger protein 707 | |
Gene Name | ZNF707 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 371 | |
Subcellular Localization | Nucleus . | |
Protein Description | May be involved in transcriptional regulation.. | |
Protein Sequence | MDMAQEPVTFRDVAIYFSREEWACLEPSQRALYRDVMLDNFSSVAALGFCSPRPDLVSRLEQWEEPWVEDRERPEFQAVQRGPRPGARKSADPKRPCDHPAWAHKKTHVRRERAREGSSFRKGFRLDTDDGQLPRAAPERTDAKPTAFPCQVLTQRCGRRPGRRERRKQRAVELSFICGTCGKALSCHSRLLAHQTVHTGTKAFECPECGQTFRWASNLQRHQKNHTREKPFCCEACGQAFSLKDRLAQHRKVHTEHRPYSCGDCGKAFKQKSNLLRHQLVHTGERPFYCADCGKAFRTKENLSHHQRVHSGEKPYTCAECGKSFRWPKGFSIHRRLHLTKRFYECGHCGKGFRHLGFFTRHQRTHRHGEV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
89 | Methylation | GPRPGARKSADPKRP CCCCCCCCCCCCCCC | 49.84 | 116253401 | |
118 | Phosphorylation | RERAREGSSFRKGFR HHHHHCCCCCCCCEE | 22.88 | - | |
119 | Phosphorylation | ERAREGSSFRKGFRL HHHHCCCCCCCCEEE | 39.67 | - | |
122 | Sumoylation | REGSSFRKGFRLDTD HCCCCCCCCEEECCC | 61.46 | - | |
122 | Sumoylation | REGSSFRKGFRLDTD HCCCCCCCCEEECCC | 61.46 | - | |
144 | Sumoylation | APERTDAKPTAFPCQ CCCCCCCCCCCCCHH | 45.79 | - | |
144 | Sumoylation | APERTDAKPTAFPCQ CCCCCCCCCCCCCHH | 45.79 | 28112733 | |
146 | Phosphorylation | ERTDAKPTAFPCQVL CCCCCCCCCCCHHHH | 39.98 | 27251275 | |
154 | Phosphorylation | AFPCQVLTQRCGRRP CCCHHHHHHHHCCCC | 18.34 | 24260401 | |
199 | Phosphorylation | LAHQTVHTGTKAFEC HHHCCCCCCCCEEEC | 42.06 | 28555341 | |
230 | Sumoylation | QKNHTREKPFCCEAC HHCCCCCCCCHHHHH | 39.85 | - | |
230 | Sumoylation | QKNHTREKPFCCEAC HHCCCCCCCCHHHHH | 39.85 | - | |
242 | Phosphorylation | EACGQAFSLKDRLAQ HHHCCEECHHHHHHH | 37.21 | 24719451 | |
283 | Phosphorylation | LRHQLVHTGERPFYC HHHHHHHCCCCCEEE | 33.00 | 28555341 | |
332 | Phosphorylation | FRWPKGFSIHRRLHL CCCCCCCCHHHHHHH | 26.59 | 23403867 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN707_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN707_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN707_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...