UniProt ID | TOR2A_HUMAN | |
---|---|---|
UniProt AC | Q5JU69 | |
Protein Name | Torsin-2A | |
Gene Name | TOR2A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 321 | |
Subcellular Localization | Endoplasmic reticulum lumen. | |
Protein Description | ||
Protein Sequence | MAAATRGCRPWGSLLGLLGLVSAAAAAWDLASLRCTLGAFCECDFRPDLPGLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKSYVSSLLAHYLFQGGLRSPRVHHFSPVLHFPHPSHIERYKKDLKSWVQGNLTACGRSLFLFDEMDKMPPGLMEVLRPFLGSSWVVYGTNYRKAIFIFISNTGGKQINQVALEAWRSRRDREEILLQELEPVISRAVLDNPHHGFSNSGIMEERLLDAVVPFLPLQRHHVRHCVLNELAQLGLEPRDEVVQAVLDSTTFFPEDEQLFSSNGCKTVASRIAFFL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MAAATRGCRPWG ---CCCCCCCCCHHH | 23.91 | 24043423 | |
13 | Phosphorylation | RGCRPWGSLLGLLGL CCCCHHHHHHHHHHH | 19.29 | 24043423 | |
22 | Phosphorylation | LGLLGLVSAAAAAWD HHHHHHHHHHHHHHH | 19.75 | 24043423 | |
32 | Phosphorylation | AAAWDLASLRCTLGA HHHHHHHHHHHCHHH | 24.52 | 24719451 | |
117 | Phosphorylation | LFQGGLRSPRVHHFS HHHCCCCCCCCCCCC | 23.31 | 17081983 | |
149 | N-linked_Glycosylation | LKSWVQGNLTACGRS HHHHHHCCCCHHCCE | 19.68 | UniProtKB CARBOHYD | |
232 | Phosphorylation | QELEPVISRAVLDNP HHHHHHHHHHHHCCC | 17.89 | - | |
244 | Phosphorylation | DNPHHGFSNSGIMEE CCCCCCCCCCCHHHH | 34.38 | - | |
246 | Phosphorylation | PHHGFSNSGIMEERL CCCCCCCCCHHHHHH | 28.62 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TOR2A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TOR2A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TOR2A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TOR2A_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...