UniProt ID | TOR2X_HUMAN | |
---|---|---|
UniProt AC | Q8N2E6 | |
Protein Name | Prosalusin | |
Gene Name | TOR2A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 242 | |
Subcellular Localization | Secreted . | |
Protein Description | Salusins -alpha and -beta may be endocrine and/or paracrine factors able to increase intracellular calcium concentrations and induce cell mitogenesis. Salusins may also be potent hypotensive peptides.. | |
Protein Sequence | MAAATRGCRPWGSLLGLLGLVSAAAAAWDLASLRCTLGAFCECDFRPDLPGLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKSYVSSLLAHYLFQGGLRSPRVHHFSPVLHFPHPSHIERYKKDLKSWVQGNLTACGRSLFLFDEMDKMPPGLMEVLRPFLGSSWVVYGTNYRKAIFIFIRWLLKLGHHGRAPPRRSGALPPAPAAPRPALRAQRAGPAGPGAKG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
149 | N-linked_Glycosylation | LKSWVQGNLTACGRS HHHHHHCCCCHHCCE | 19.68 | UniProtKB CARBOHYD | |
241 | Lysine amide | GPAGPGAKG------ CCCCCCCCC------ | 71.69 | - | |
241 | Amidation | GPAGPGAKG------ CCCCCCCCC------ | 71.69 | 12910263 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TOR2X_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TOR2X_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TOR2X_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TOR2X_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Amidation | |
Reference | PubMed |
"Salusins: newly identified bioactive peptides with hemodynamic andmitogenic activities."; Shichiri M., Ishimaru S., Ota T., Nishikawa T., Isogai T., Hirata Y.; Nat. Med. 9:1166-1172(2003). Cited for: FUNCTION OF SALUSINS, TISSUE SPECIFICITY, AMIDATION AT LYS-241, ANDSUBCELLULAR LOCATION. |