UniProt ID | RT02_HUMAN | |
---|---|---|
UniProt AC | Q9Y399 | |
Protein Name | 28S ribosomal protein S2, mitochondrial | |
Gene Name | MRPS2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 296 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIRESEDSTDFNDKILNEPLKHSDFFNVKELFSVRSLFDARVHLGHKAGCRHRFMEPYIFGSRLDHDIIDLEQTATHLQLALNFTAHMAYRKGIILFISRNRQFSYLIENMARDCGEYAHTRYFRGGMLTNARLLFGPTVRLPDLIIFLHTLNNIFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGADMSHSL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MATSSAALPRI ----CCCCHHHHHHH | 14.40 | 18491316 | |
5 | Phosphorylation | ---MATSSAALPRIL ---CCCCHHHHHHHH | 17.13 | 18491316 | |
28 | Ubiquitination | RWLGFLGKATPRPAR HHHHHCCCCCCCCCC | 51.76 | - | |
30 | Phosphorylation | LGFLGKATPRPARPS HHHCCCCCCCCCCCC | 24.26 | - | |
37 | Phosphorylation | TPRPARPSRRTLGSA CCCCCCCCCCCCCCC | 28.92 | - | |
40 | Phosphorylation | PARPSRRTLGSATAL CCCCCCCCCCCCEEE | 34.07 | 22210691 | |
61 | Ubiquitination | DSTDFNDKILNEPLK CCCCCCHHHHCCCCC | 50.64 | 21906983 | |
68 | Acetylation | KILNEPLKHSDFFNV HHHCCCCCCCCCCCH | 52.34 | 25953088 | |
68 | Ubiquitination | KILNEPLKHSDFFNV HHHCCCCCCCCCCCH | 52.34 | 21906983 | |
76 | Ubiquitination | HSDFFNVKELFSVRS CCCCCCHHHHHCHHH | 50.21 | 21963094 | |
84 | Ubiquitination | ELFSVRSLFDARVHL HHHCHHHHHHCHHHH | 2.93 | 21906983 | |
91 | Ubiquitination | LFDARVHLGHKAGCR HHHCHHHHCCCCCCC | 7.61 | 21906983 | |
99 | Ubiquitination | GHKAGCRHRFMEPYI CCCCCCCCCCCCCEE | 31.26 | 21963094 | |
109 | Phosphorylation | MEPYIFGSRLDHDII CCCEECCCCCCCCEE | 20.94 | 24719451 | |
146 | Phosphorylation | KGIILFISRNRQFSY CCEEEEEECCHHHHH | 19.03 | 20068231 | |
152 | Phosphorylation | ISRNRQFSYLIENMA EECCHHHHHHHHHHH | 15.64 | 29083192 | |
153 | Phosphorylation | SRNRQFSYLIENMAR ECCHHHHHHHHHHHH | 17.00 | 29083192 | |
255 | Phosphorylation | LYCRLFQTAITRAKE HHHHHHHHHHHHHHH | 16.82 | 20068231 | |
258 | Phosphorylation | RLFQTAITRAKEKRQ HHHHHHHHHHHHHHH | 23.31 | 20068231 | |
271 | Phosphorylation | RQQVEALYRLQGQKE HHHHHHHHHHCCCCC | 19.14 | - | |
277 | Ubiquitination | LYRLQGQKEPGDQGP HHHHCCCCCCCCCCC | 73.10 | 29967540 | |
300 | Ubiquitination | SHSL----------- CCCC----------- | 24816145 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RT02_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RT02_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RT02_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...