| UniProt ID | RT02_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y399 | |
| Protein Name | 28S ribosomal protein S2, mitochondrial | |
| Gene Name | MRPS2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 296 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | ||
| Protein Sequence | MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIRESEDSTDFNDKILNEPLKHSDFFNVKELFSVRSLFDARVHLGHKAGCRHRFMEPYIFGSRLDHDIIDLEQTATHLQLALNFTAHMAYRKGIILFISRNRQFSYLIENMARDCGEYAHTRYFRGGMLTNARLLFGPTVRLPDLIIFLHTLNNIFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGADMSHSL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MATSSAALPRI ----CCCCHHHHHHH | 14.40 | 18491316 | |
| 5 | Phosphorylation | ---MATSSAALPRIL ---CCCCHHHHHHHH | 17.13 | 18491316 | |
| 28 | Ubiquitination | RWLGFLGKATPRPAR HHHHHCCCCCCCCCC | 51.76 | - | |
| 30 | Phosphorylation | LGFLGKATPRPARPS HHHCCCCCCCCCCCC | 24.26 | - | |
| 37 | Phosphorylation | TPRPARPSRRTLGSA CCCCCCCCCCCCCCC | 28.92 | - | |
| 40 | Phosphorylation | PARPSRRTLGSATAL CCCCCCCCCCCCEEE | 34.07 | 22210691 | |
| 61 | Ubiquitination | DSTDFNDKILNEPLK CCCCCCHHHHCCCCC | 50.64 | 21906983 | |
| 68 | Acetylation | KILNEPLKHSDFFNV HHHCCCCCCCCCCCH | 52.34 | 25953088 | |
| 68 | Ubiquitination | KILNEPLKHSDFFNV HHHCCCCCCCCCCCH | 52.34 | 21906983 | |
| 76 | Ubiquitination | HSDFFNVKELFSVRS CCCCCCHHHHHCHHH | 50.21 | 21963094 | |
| 84 | Ubiquitination | ELFSVRSLFDARVHL HHHCHHHHHHCHHHH | 2.93 | 21906983 | |
| 91 | Ubiquitination | LFDARVHLGHKAGCR HHHCHHHHCCCCCCC | 7.61 | 21906983 | |
| 99 | Ubiquitination | GHKAGCRHRFMEPYI CCCCCCCCCCCCCEE | 31.26 | 21963094 | |
| 109 | Phosphorylation | MEPYIFGSRLDHDII CCCEECCCCCCCCEE | 20.94 | 24719451 | |
| 146 | Phosphorylation | KGIILFISRNRQFSY CCEEEEEECCHHHHH | 19.03 | 20068231 | |
| 152 | Phosphorylation | ISRNRQFSYLIENMA EECCHHHHHHHHHHH | 15.64 | 29083192 | |
| 153 | Phosphorylation | SRNRQFSYLIENMAR ECCHHHHHHHHHHHH | 17.00 | 29083192 | |
| 255 | Phosphorylation | LYCRLFQTAITRAKE HHHHHHHHHHHHHHH | 16.82 | 20068231 | |
| 258 | Phosphorylation | RLFQTAITRAKEKRQ HHHHHHHHHHHHHHH | 23.31 | 20068231 | |
| 271 | Phosphorylation | RQQVEALYRLQGQKE HHHHHHHHHHCCCCC | 19.14 | - | |
| 277 | Ubiquitination | LYRLQGQKEPGDQGP HHHHCCCCCCCCCCC | 73.10 | 29967540 | |
| 300 | Ubiquitination | SHSL----------- CCCC----------- | 24816145 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RT02_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RT02_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RT02_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...