UniProt ID | TPD52_HUMAN | |
---|---|---|
UniProt AC | P55327 | |
Protein Name | Tumor protein D52 | |
Gene Name | TPD52 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 224 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKFGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
28 | Phosphorylation | GVNKSYLYLSPSGNS CCCCCEEEECCCCCC | 9.26 | 28102081 | |
30 | Phosphorylation | NKSYLYLSPSGNSSP CCCEEEECCCCCCCC | 11.94 | 24719451 | |
32 | Phosphorylation | SYLYLSPSGNSSPPG CEEEECCCCCCCCCC | 47.43 | 26657352 | |
35 | Phosphorylation | YLSPSGNSSPPGSPT EECCCCCCCCCCCCH | 47.98 | 26657352 | |
36 | Phosphorylation | LSPSGNSSPPGSPTL ECCCCCCCCCCCCHH | 38.83 | 25849741 | |
40 | Phosphorylation | GNSSPPGSPTLQKFG CCCCCCCCCHHHHHC | 22.08 | 26657352 | |
42 | Phosphorylation | SSPPGSPTLQKFGLL CCCCCCCHHHHHCCE | 43.44 | 28102081 | |
45 | Ubiquitination | PGSPTLQKFGLLRTD CCCCHHHHHCCEECC | 44.50 | 29967540 | |
60 | Ubiquitination | PVPEEGEDVAATISA CCCCCCCCHHHHHCC | 46.33 | 21890473 | |
60 | Ubiquitination | PVPEEGEDVAATISA CCCCCCCCHHHHHCC | 46.33 | 21963094 | |
60 (in isoform 2) | Ubiquitination | - | 46.33 | 21890473 | |
62 | Ubiquitination | PEEGEDVAATISATE CCCCCCHHHHHCCCC | 15.94 | 30230243 | |
64 | Phosphorylation | EGEDVAATISATETL CCCCHHHHHCCCCCC | 13.01 | 28348404 | |
66 | Phosphorylation | EDVAATISATETLSE CCHHHHHCCCCCCCH | 25.45 | 28348404 | |
68 | Phosphorylation | VAATISATETLSEEE HHHHHCCCCCCCHHH | 23.78 | 24719451 | |
68 | Ubiquitination | VAATISATETLSEEE HHHHHCCCCCCCHHH | 23.78 | 29967540 | |
70 | Phosphorylation | ATISATETLSEEEQE HHHCCCCCCCHHHHH | 31.09 | 28348404 | |
70 | Ubiquitination | ATISATETLSEEEQE HHHCCCCCCCHHHHH | 31.09 | 29967540 | |
72 | Phosphorylation | ISATETLSEEEQEEL HCCCCCCCHHHHHHH | 50.83 | 22817901 | |
80 | Ubiquitination | EEEQEELRRELAKVE HHHHHHHHHHHHHHH | 33.05 | 23000965 | |
80 (in isoform 2) | Ubiquitination | - | 33.05 | 21890473 | |
85 | Ubiquitination | ELRRELAKVEEEIQT HHHHHHHHHHHHHHH | 63.90 | 21890473 | |
85 | Ubiquitination | ELRRELAKVEEEIQT HHHHHHHHHHHHHHH | 63.90 | 23000965 | |
85 (in isoform 2) | Ubiquitination | - | 63.90 | 21890473 | |
93 | Phosphorylation | VEEEIQTLSQVLAAK HHHHHHHHHHHHHHH | 1.61 | 18669648 | |
97 | Ubiquitination | IQTLSQVLAAKEKHL HHHHHHHHHHHHHHH | 2.73 | 21890473 | |
97 | Ubiquitination | IQTLSQVLAAKEKHL HHHHHHHHHHHHHHH | 2.73 | 23000965 | |
97 (in isoform 2) | Ubiquitination | - | 2.73 | 21890473 | |
98 | Ubiquitination | QTLSQVLAAKEKHLA HHHHHHHHHHHHHHH | 20.03 | 23000965 | |
98 (in isoform 2) | Ubiquitination | - | 20.03 | 21890473 | |
100 | Acetylation | LSQVLAAKEKHLAEI HHHHHHHHHHHHHHH | 62.78 | - | |
100 | Ubiquitination | LSQVLAAKEKHLAEI HHHHHHHHHHHHHHH | 62.78 | - | |
100 | Ubiquitination | LSQVLAAKEKHLAEI HHHHHHHHHHHHHHH | 62.78 | 21890473 | |
100 | Ubiquitination | LSQVLAAKEKHLAEI HHHHHHHHHHHHHHH | 62.78 | 21890473 | |
100 | Ubiquitination | LSQVLAAKEKHLAEI HHHHHHHHHHHHHHH | 62.78 | 21890473 | |
100 | Ubiquitination | LSQVLAAKEKHLAEI HHHHHHHHHHHHHHH | 62.78 | 21890473 | |
100 | Ubiquitination | LSQVLAAKEKHLAEI HHHHHHHHHHHHHHH | 62.78 | 21890473 | |
100 | 2-Hydroxyisobutyrylation | LSQVLAAKEKHLAEI HHHHHHHHHHHHHHH | 62.78 | - | |
100 | Acetylation | LSQVLAAKEKHLAEI HHHHHHHHHHHHHHH | 62.78 | 23236377 | |
100 | Succinylation | LSQVLAAKEKHLAEI HHHHHHHHHHHHHHH | 62.78 | 23954790 | |
100 | Ubiquitination | LSQVLAAKEKHLAEI HHHHHHHHHHHHHHH | 62.78 | 21963094 | |
100 (in isoform 1) | Ubiquitination | - | 62.78 | 21890473 | |
100 | Ubiquitination | LSQVLAAKEKHLAEI HHHHHHHHHHHHHHH | 62.78 | 22053931 | |
102 | Ubiquitination | QVLAAKEKHLAEIKR HHHHHHHHHHHHHHH | 43.12 | - | |
102 | 2-Hydroxyisobutyrylation | QVLAAKEKHLAEIKR HHHHHHHHHHHHHHH | 43.12 | - | |
102 | Acetylation | QVLAAKEKHLAEIKR HHHHHHHHHHHHHHH | 43.12 | 25953088 | |
102 | Ubiquitination | QVLAAKEKHLAEIKR HHHHHHHHHHHHHHH | 43.12 | 30230243 | |
104 | Phosphorylation | LAAKEKHLAEIKRKL HHHHHHHHHHHHHHH | 7.29 | 33259812 | |
108 | 2-Hydroxyisobutyrylation | EKHLAEIKRKLGINS HHHHHHHHHHHCCCH | 34.68 | - | |
108 | Acetylation | EKHLAEIKRKLGINS HHHHHHHHHHHCCCH | 34.68 | 27452117 | |
108 | Ubiquitination | EKHLAEIKRKLGINS HHHHHHHHHHHCCCH | 34.68 | 29967540 | |
109 | Ubiquitination | KHLAEIKRKLGINSL HHHHHHHHHHCCCHH | 45.13 | 32015554 | |
109 (in isoform 2) | Ubiquitination | - | 45.13 | 21890473 | |
110 | Ubiquitination | HLAEIKRKLGINSLQ HHHHHHHHHCCCHHH | 46.17 | 29967540 | |
115 | Phosphorylation | KRKLGINSLQELKQN HHHHCCCHHHHHHHH | 29.52 | 27050516 | |
120 | Ubiquitination | INSLQELKQNIAKGW CCHHHHHHHHHHHCC | 40.31 | - | |
120 | Ubiquitination | INSLQELKQNIAKGW CCHHHHHHHHHHHCC | 40.31 | 21890473 | |
120 | Acetylation | INSLQELKQNIAKGW CCHHHHHHHHHHHCC | 40.31 | 27452117 | |
120 | Ubiquitination | INSLQELKQNIAKGW CCHHHHHHHHHHHCC | 40.31 | 23000965 | |
120 (in isoform 1) | Ubiquitination | - | 40.31 | 21890473 | |
123 | Ubiquitination | LQELKQNIAKGWQDV HHHHHHHHHHCCCHH | 3.77 | 29967540 | |
124 (in isoform 3) | Ubiquitination | - | 16.32 | 21890473 | |
125 | Ubiquitination | ELKQNIAKGWQDVTA HHHHHHHHCCCHHHH | 57.81 | - | |
125 | Ubiquitination | ELKQNIAKGWQDVTA HHHHHHHHCCCHHHH | 57.81 | 21890473 | |
125 | Ubiquitination | ELKQNIAKGWQDVTA HHHHHHHHCCCHHHH | 57.81 | 21890473 | |
125 | Ubiquitination | ELKQNIAKGWQDVTA HHHHHHHHCCCHHHH | 57.81 | 21890473 | |
125 | Ubiquitination | ELKQNIAKGWQDVTA HHHHHHHHCCCHHHH | 57.81 | 21890473 | |
125 | Ubiquitination | ELKQNIAKGWQDVTA HHHHHHHHCCCHHHH | 57.81 | 23000965 | |
125 (in isoform 1) | Ubiquitination | - | 57.81 | 21890473 | |
129 | Ubiquitination | NIAKGWQDVTATSAY HHHHCCCHHHHHHHH | 32.97 | 32015554 | |
131 | Phosphorylation | AKGWQDVTATSAYKK HHCCCHHHHHHHHHH | 32.29 | 20068231 | |
131 (in isoform 8) | Phosphorylation | - | 32.29 | 29083192 | |
133 | O-linked_Glycosylation | GWQDVTATSAYKKTS CCCHHHHHHHHHHHH | 12.43 | 28657654 | |
133 | Phosphorylation | GWQDVTATSAYKKTS CCCHHHHHHHHHHHH | 12.43 | 18669648 | |
133 (in isoform 8) | Phosphorylation | - | 12.43 | 29083192 | |
134 | Phosphorylation | WQDVTATSAYKKTSE CCHHHHHHHHHHHHH | 27.43 | 21815630 | |
134 (in isoform 4) | Phosphorylation | - | 27.43 | 30108239 | |
134 (in isoform 8) | Phosphorylation | - | 27.43 | 29083192 | |
135 | Ubiquitination | QDVTATSAYKKTSET CHHHHHHHHHHHHHH | 18.79 | 32015554 | |
136 | Phosphorylation | DVTATSAYKKTSETL HHHHHHHHHHHHHHH | 16.88 | 20068231 | |
136 (in isoform 4) | Phosphorylation | - | 16.88 | 30108239 | |
137 | Ubiquitination | VTATSAYKKTSETLS HHHHHHHHHHHHHHH | 49.65 | - | |
137 | Ubiquitination | VTATSAYKKTSETLS HHHHHHHHHHHHHHH | 49.65 | 21890473 | |
137 | Ubiquitination | VTATSAYKKTSETLS HHHHHHHHHHHHHHH | 49.65 | 21890473 | |
137 | Ubiquitination | VTATSAYKKTSETLS HHHHHHHHHHHHHHH | 49.65 | 21890473 | |
137 | Ubiquitination | VTATSAYKKTSETLS HHHHHHHHHHHHHHH | 49.65 | 21890473 | |
137 | 2-Hydroxyisobutyrylation | VTATSAYKKTSETLS HHHHHHHHHHHHHHH | 49.65 | - | |
137 | Acetylation | VTATSAYKKTSETLS HHHHHHHHHHHHHHH | 49.65 | 25953088 | |
137 | Succinylation | VTATSAYKKTSETLS HHHHHHHHHHHHHHH | 49.65 | 23954790 | |
137 | Ubiquitination | VTATSAYKKTSETLS HHHHHHHHHHHHHHH | 49.65 | 23000965 | |
137 (in isoform 1) | Ubiquitination | - | 49.65 | 21890473 | |
137 (in isoform 8) | Phosphorylation | - | 49.65 | 29083192 | |
138 | Ubiquitination | TATSAYKKTSETLSQ HHHHHHHHHHHHHHH | 44.61 | - | |
138 | Acetylation | TATSAYKKTSETLSQ HHHHHHHHHHHHHHH | 44.61 | 156609 | |
138 | Ubiquitination | TATSAYKKTSETLSQ HHHHHHHHHHHHHHH | 44.61 | 23000965 | |
138 (in isoform 1) | Ubiquitination | - | 44.61 | 21890473 | |
138 (in isoform 4) | Phosphorylation | - | 44.61 | 24117733 | |
139 | Phosphorylation | ATSAYKKTSETLSQA HHHHHHHHHHHHHHH | 27.87 | 29396449 | |
140 | Phosphorylation | TSAYKKTSETLSQAG HHHHHHHHHHHHHHH | 37.15 | 29496963 | |
140 | Ubiquitination | TSAYKKTSETLSQAG HHHHHHHHHHHHHHH | 37.15 | 33845483 | |
140 (in isoform 2) | Ubiquitination | - | 37.15 | 21890473 | |
141 (in isoform 4) | Phosphorylation | - | 60.03 | 24117733 | |
142 | Phosphorylation | AYKKTSETLSQAGQK HHHHHHHHHHHHHHH | 31.32 | 25159151 | |
144 | Phosphorylation | KKTSETLSQAGQKAS HHHHHHHHHHHHHHH | 25.96 | 25159151 | |
144 (in isoform 3) | Ubiquitination | - | 25.96 | 21890473 | |
145 | Ubiquitination | KTSETLSQAGQKASA HHHHHHHHHHHHHHH | 53.26 | 33845483 | |
145 (in isoform 4) | Phosphorylation | - | 53.26 | 24117733 | |
147 | Ubiquitination | SETLSQAGQKASAAF HHHHHHHHHHHHHHH | 23.14 | 29967540 | |
147 (in isoform 2) | Ubiquitination | - | 23.14 | 21890473 | |
147 (in isoform 4) | Phosphorylation | - | 23.14 | 29691806 | |
149 | Ubiquitination | TLSQAGQKASAAFSS HHHHHHHHHHHHHHH | 43.31 | - | |
149 | Acetylation | TLSQAGQKASAAFSS HHHHHHHHHHHHHHH | 43.31 | 25953088 | |
149 | Ubiquitination | TLSQAGQKASAAFSS HHHHHHHHHHHHHHH | 43.31 | 21906983 | |
149 (in isoform 1) | Ubiquitination | - | 43.31 | 21890473 | |
149 (in isoform 3) | Ubiquitination | - | 43.31 | 21890473 | |
151 | Phosphorylation | SQAGQKASAAFSSVG HHHHHHHHHHHHHHH | 27.45 | 21406692 | |
152 | Ubiquitination | QAGQKASAAFSSVGS HHHHHHHHHHHHHHH | 19.86 | 33845483 | |
152 (in isoform 2) | Ubiquitination | - | 19.86 | 21890473 | |
154 (in isoform 4) | Phosphorylation | - | 5.82 | 22210691 | |
155 | Phosphorylation | QKASAAFSSVGSVIT HHHHHHHHHHHHHHH | 21.27 | 25159151 | |
156 | O-linked_Glycosylation | KASAAFSSVGSVITK HHHHHHHHHHHHHHH | 24.84 | OGP | |
156 | Phosphorylation | KASAAFSSVGSVITK HHHHHHHHHHHHHHH | 24.84 | 25159151 | |
156 (in isoform 4) | Phosphorylation | - | 24.84 | 18669648 | |
158 | Ubiquitination | SAAFSSVGSVITKKL HHHHHHHHHHHHHCH | 20.38 | 32015554 | |
159 | Phosphorylation | AAFSSVGSVITKKLE HHHHHHHHHHHHCHH | 14.27 | 25159151 | |
159 (in isoform 4) | Phosphorylation | - | 14.27 | 25849741 | |
161 (in isoform 3) | Ubiquitination | - | 5.11 | 21890473 | |
162 | Phosphorylation | SSVGSVITKKLEDVK HHHHHHHHHCHHHHC | 21.70 | 28464451 | |
162 (in isoform 3) | Ubiquitination | - | 21.70 | 21890473 | |
163 | 2-Hydroxyisobutyrylation | SVGSVITKKLEDVKN HHHHHHHHCHHHHCC | 44.21 | - | |
163 | Acetylation | SVGSVITKKLEDVKN HHHHHHHHCHHHHCC | 44.21 | 25953088 | |
163 | Ubiquitination | SVGSVITKKLEDVKN HHHHHHHHCHHHHCC | 44.21 | 29967540 | |
168 | Ubiquitination | ITKKLEDVKNSPTFK HHHCHHHHCCCCCCH | 4.64 | 33845483 | |
169 | 2-Hydroxyisobutyrylation | TKKLEDVKNSPTFKS HHCHHHHCCCCCCHH | 65.12 | - | |
169 | Ubiquitination | TKKLEDVKNSPTFKS HHCHHHHCCCCCCHH | 65.12 | 32015554 | |
170 | Ubiquitination | KKLEDVKNSPTFKSF HCHHHHCCCCCCHHH | 53.74 | 29967540 | |
171 | Phosphorylation | KLEDVKNSPTFKSFE CHHHHCCCCCCHHHH | 21.43 | 29255136 | |
172 (in isoform 5) | Phosphorylation | - | 51.77 | 24117733 | |
173 | Phosphorylation | EDVKNSPTFKSFEEK HHHCCCCCCHHHHHH | 43.44 | 29255136 | |
173 (in isoform 3) | Ubiquitination | - | 43.44 | 21890473 | |
174 (in isoform 6) | Phosphorylation | - | 7.67 | 30108239 | |
175 | Acetylation | VKNSPTFKSFEEKVE HCCCCCCHHHHHHHH | 57.63 | 25953088 | |
175 | Ubiquitination | VKNSPTFKSFEEKVE HCCCCCCHHHHHHHH | 57.63 | 32015554 | |
176 | Phosphorylation | KNSPTFKSFEEKVEN CCCCCCHHHHHHHHH | 33.43 | 22167270 | |
176 (in isoform 5) | Phosphorylation | - | 33.43 | 24117733 | |
176 (in isoform 6) | Phosphorylation | - | 33.43 | 30108239 | |
176 (in isoform 7) | Phosphorylation | - | 33.43 | - | |
178 (in isoform 5) | Phosphorylation | - | 65.09 | 29691806 | |
178 (in isoform 6) | Phosphorylation | - | 65.09 | 24117733 | |
179 | Ubiquitination | PTFKSFEEKVENLKS CCCHHHHHHHHHHHH | 61.46 | 29967540 | |
179 (in isoform 2) | Ubiquitination | - | 61.46 | 21890473 | |
180 | Acetylation | TFKSFEEKVENLKSK CCHHHHHHHHHHHHH | 47.88 | 27452117 | |
180 | Ubiquitination | TFKSFEEKVENLKSK CCHHHHHHHHHHHHH | 47.88 | 21906983 | |
180 (in isoform 1) | Ubiquitination | - | 47.88 | 21890473 | |
180 (in isoform 7) | Phosphorylation | - | 47.88 | 22210691 | |
181 (in isoform 6) | Phosphorylation | - | 7.16 | 24117733 | |
182 (in isoform 7) | Phosphorylation | - | 68.84 | 22210691 | |
184 | Ubiquitination | FEEKVENLKSKVGGT HHHHHHHHHHHHCCC | 4.13 | 32015554 | |
185 | Ubiquitination | EEKVENLKSKVGGTK HHHHHHHHHHHCCCC | 60.87 | 33845483 | |
185 (in isoform 5) | Phosphorylation | - | 60.87 | 22210691 | |
185 (in isoform 6) | Phosphorylation | - | 60.87 | 24117733 | |
185 (in isoform 7) | Phosphorylation | - | 60.87 | 20166139 | |
187 | Ubiquitination | KVENLKSKVGGTKPA HHHHHHHHHCCCCCC | 43.22 | 21906983 | |
187 (in isoform 1) | Ubiquitination | - | 43.22 | 21890473 | |
187 (in isoform 5) | Phosphorylation | - | 43.22 | 18669648 | |
187 (in isoform 6) | Phosphorylation | - | 43.22 | 29691806 | |
189 | Ubiquitination | ENLKSKVGGTKPAGG HHHHHHHCCCCCCCC | 41.61 | 32015554 | |
190 (in isoform 5) | Phosphorylation | - | 33.29 | 25849741 | |
191 | Phosphorylation | LKSKVGGTKPAGGDF HHHHHCCCCCCCCCH | 28.11 | 23927012 | |
192 | Acetylation | KSKVGGTKPAGGDFG HHHHCCCCCCCCCHH | 35.82 | 26051181 | |
192 | Ubiquitination | KSKVGGTKPAGGDFG HHHHCCCCCCCCCHH | 35.82 | 33845483 | |
192 (in isoform 1) | Ubiquitination | - | 35.82 | 21890473 | |
194 | Ubiquitination | KVGGTKPAGGDFGEV HHCCCCCCCCCHHHH | 35.84 | - | |
194 | Ubiquitination | KVGGTKPAGGDFGEV HHCCCCCCCCCHHHH | 35.84 | 33845483 | |
194 (in isoform 6) | Phosphorylation | - | 35.84 | 22210691 | |
196 | Ubiquitination | GGTKPAGGDFGEVLN CCCCCCCCCHHHHHH | 29.22 | 29967540 | |
196 (in isoform 6) | Phosphorylation | - | 29.22 | 18669648 | |
198 | Ubiquitination | TKPAGGDFGEVLNSA CCCCCCCHHHHHHHH | 11.55 | 32015554 | |
199 | Ubiquitination | KPAGGDFGEVLNSAA CCCCCCHHHHHHHHH | 28.92 | 33845483 | |
199 (in isoform 6) | Phosphorylation | - | 28.92 | 25849741 | |
201 | Ubiquitination | AGGDFGEVLNSAANA CCCCHHHHHHHHHCC | 6.66 | - | |
201 | Ubiquitination | AGGDFGEVLNSAANA CCCCHHHHHHHHHCC | 6.66 | 33845483 | |
202 | Ubiquitination | GGDFGEVLNSAANAS CCCHHHHHHHHHCCC | 3.49 | 29967540 | |
204 | Phosphorylation | DFGEVLNSAANASAT CHHHHHHHHHCCCCC | 25.29 | 23927012 | |
204 (in isoform 3) | Ubiquitination | - | 25.29 | 21890473 | |
206 | Ubiquitination | GEVLNSAANASATTT HHHHHHHHCCCCCCC | 16.37 | - | |
206 | Ubiquitination | GEVLNSAANASATTT HHHHHHHHCCCCCCC | 16.37 | 33845483 | |
208 | Ubiquitination | VLNSAANASATTTEP HHHHHHCCCCCCCCC | 8.87 | 33845483 | |
209 | Phosphorylation | LNSAANASATTTEPL HHHHHCCCCCCCCCC | 26.42 | 25159151 | |
210 | Ubiquitination | NSAANASATTTEPLP HHHHCCCCCCCCCCC | 13.42 | 29967540 | |
211 | Phosphorylation | SAANASATTTEPLPE HHHCCCCCCCCCCCH | 31.58 | 23927012 | |
211 (in isoform 3) | Ubiquitination | - | 31.58 | 21890473 | |
212 | Phosphorylation | AANASATTTEPLPEK HHCCCCCCCCCCCHH | 28.95 | 23927012 | |
213 | Phosphorylation | ANASATTTEPLPEKT HCCCCCCCCCCCHHH | 31.11 | 23927012 | |
215 | Ubiquitination | ASATTTEPLPEKTQE CCCCCCCCCCHHHHH | 51.64 | 33845483 | |
216 (in isoform 3) | Ubiquitination | - | 7.52 | 21890473 | |
219 | Acetylation | TTEPLPEKTQESL-- CCCCCCHHHHHCC-- | 54.27 | 25953088 | |
219 | Ubiquitination | TTEPLPEKTQESL-- CCCCCCHHHHHCC-- | 54.27 | 29967540 | |
219 (in isoform 1) | Ubiquitination | - | 54.27 | 21890473 | |
220 | Phosphorylation | TEPLPEKTQESL--- CCCCCHHHHHCC--- | 35.59 | 23927012 | |
223 | Phosphorylation | LPEKTQESL------ CCHHHHHCC------ | 29.57 | 30278072 | |
228 | Ubiquitination | QESL----------- HHCC----------- | 29967540 | ||
233 | Ubiquitination | ---------------- ---------------- | - | ||
233 | Ubiquitination | ---------------- ---------------- | 29967540 | ||
242 | Ubiquitination | ------------------------- ------------------------- | 29967540 | ||
243 (in isoform 3) | Ubiquitination | - | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
176 | S | Phosphorylation | Kinase | CAMK2D | Q13557-8 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPD52_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPD52_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MAL2_HUMAN | MAL2 | physical | 11549320 | |
TPD52_HUMAN | TPD52 | physical | 9484778 | |
TPD53_HUMAN | TPD52L1 | physical | 9484778 | |
TPD54_HUMAN | TPD52L2 | physical | 9484778 | |
ARC1B_HUMAN | ARPC1B | physical | 22863883 | |
PDIA6_HUMAN | PDIA6 | physical | 22863883 | |
KAPCA_HUMAN | PRKACA | physical | 22863883 | |
TPD54_HUMAN | TPD52L2 | physical | 22863883 | |
CALU_HUMAN | CALU | physical | 26344197 | |
CLIC4_HUMAN | CLIC4 | physical | 26344197 | |
DUT_HUMAN | DUT | physical | 26344197 | |
ENOG_HUMAN | ENO2 | physical | 26344197 | |
EZRI_HUMAN | EZR | physical | 26344197 | |
NACA2_HUMAN | NACA2 | physical | 26344197 | |
PAIP1_HUMAN | PAIP1 | physical | 26344197 | |
PHB_HUMAN | PHB | physical | 26344197 | |
TEBP_HUMAN | PTGES3 | physical | 26344197 | |
UCHL3_HUMAN | UCHL3 | physical | 26344197 | |
ANDR_HUMAN | AR | physical | 27835608 | |
CHIP_HUMAN | STUB1 | physical | 27835608 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-171; THR-173; SER-176AND SER-223, AND MASS SPECTROMETRY. | |
"Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column."; Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y.; Anal. Sci. 24:161-166(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-171 AND THR-173, ANDMASS SPECTROMETRY. | |
"Global proteomic profiling of phosphopeptides using electron transferdissociation tandem mass spectrometry."; Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A.; Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-171; THR-173 ANDSER-176, AND MASS SPECTROMETRY. | |
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-171, AND MASSSPECTROMETRY. |