ZN747_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ZN747_HUMAN
• UniProt AC: Q9BV97
• Protein Name: KRAB domain-containing protein ZNF747
• Gene Name: ZNF747
• Organism: Homo sapiens (Human).
• Sequence Length: 191
• Protein Sequence: MTDPSLGLTVPMAPPLAPLPPRDPNGAGSEWRKPGAVSFADVAVYFSREEWGCLRPAQRALYRDVMRETYGHLGALGESPTCLPGPCASTGPAAPLGAACGVGGPGAGQAASSQRGVCVLLPQESEAASRRSSPGWRRRPNCGIRLPRIRRWRSVRQKRTQQIPETRKRKDKGKGREPWRSPTLWPPGLLG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTDPSLGLT ------CCCCCCCCC	57.53	30624053
5	Phosphorylation	---MTDPSLGLTVPM ---CCCCCCCCCCCC	37.57	30624053
9	Phosphorylation	TDPSLGLTVPMAPPL CCCCCCCCCCCCCCC	22.29	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ZN747_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ZN747_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ZN747_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SUFU_HUMAN	SUFU	physical	28514442
MZB1_HUMAN	MZB1	physical	28514442
TIF1B_HUMAN	TRIM28	physical	28514442
CYGB_HUMAN	CYGB	physical	28514442
MRS2_HUMAN	MRS2	physical	28514442
IL18_HUMAN	IL18	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.