| UniProt ID | MZB1_HUMAN | |
|---|---|---|
| UniProt AC | Q8WU39 | |
| Protein Name | Marginal zone B- and B1-cell-specific protein | |
| Gene Name | MZB1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 189 | |
| Subcellular Localization |
Isoform 1: Endoplasmic reticulum lumen . Secreted . Isoform 2: Cytoplasm . Diffuse granular localization in the cytoplasm surrounding the nucleus (PubMed:11350957). |
|
| Protein Description | Associates with immunoglobulin M (IgM) heavy and light chains and promotes IgM assembly and secretion. May exert its effect by acting as a molecular chaperone or as an oxidoreductase as it displays a low level of oxidoreductase activity (By similarity). Isoform 2 may be involved in regulation of apoptosis. Helps to diversify peripheral B-cell functions by regulating Ca(2+) stores, antibody secretion and integrin activation.; Acts as a hormone-regulated adipokine/proinflammatory cytokine that is implicated in causing chronic inflammation, affecting cellular expansion and blunting insulin response in adipocytes. May have a role in the onset of insulin resistance.. | |
| Protein Sequence | MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 28 | O-linked_Glycosylation | LGDRAPLTATAPQLD CCCCCCCEEECCCCC | OGP | ||
| 30 | O-linked_Glycosylation | DRAPLTATAPQLDDE CCCCCEEECCCCCHH | OGP | ||
| 41 | O-linked_Glycosylation | LDDEEMYSAHMPAHL CCHHHHHHCCCCHHH | OGP | ||
| 66 | Ubiquitination | QMWQNLAKAETKLHT HHHHHHHHHHHHCCC | 22817900 | ||
| 70 | Ubiquitination | NLAKAETKLHTSNSG HHHHHHHHCCCCCCC | 22817900 | ||
| 70 | Acetylation | NLAKAETKLHTSNSG HHHHHHHHCCCCCCC | 25953088 | ||
| 70 (in isoform 1) | Ubiquitination | - | 21906983 | ||
| 125 | O-linked_Glycosylation | LSEGPEPSISVMVTG CCCCCCCCEEEEEEC | OGP | ||
| 181 | Ubiquitination | PQGACSEKVSATREE CCCCCCHHHCCHHHC | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MZB1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MZB1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MZB1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of MZB1_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
