CYGB_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CYGB_HUMAN
• UniProt AC: Q8WWM9
• Protein Name: Cytoglobin
• Gene Name: CYGB
• Organism: Homo sapiens (Human).
• Sequence Length: 190
• Subcellular Localization: Cytoplasm.
• Protein Description: May have a protective function during conditions of oxidative stress. May be involved in intracellular oxygen storage or transfer..
• Protein Sequence: MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
75	Phosphorylation	DPLEMERSPQLRKHA CHHHHCCCHHHHHHH	12.05	23663014
179	Phosphorylation	VQQVPNATTPPATLP CEECCCCCCCCCCCC	46.61	26657352
180	Phosphorylation	QQVPNATTPPATLPS EECCCCCCCCCCCCC	25.51	28192239
184	Phosphorylation	NATTPPATLPSSGP- CCCCCCCCCCCCCC-	45.00	28857561

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	SKP2	Q13309	PMID:28948618

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CYGB_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CYGB_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DDI1_HUMAN	DDI1	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.