| UniProt ID | DKK1_HUMAN | |
|---|---|---|
| UniProt AC | O94907 | |
| Protein Name | Dickkopf-related protein 1 | |
| Gene Name | DKK1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 266 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. [PubMed: 22000856 DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease] | |
| Protein Sequence | MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 61 | O-linked_Glycosylation | GHPGSAVSAAPGILY CCCCCHHHCCCCEEE | 20.59 | 21805521 | |
| 132 | Phosphorylation | AMCCPGNYCKNGICV HHCCCCCCCCCCEEE | 15.66 | - | |
| 140 | Phosphorylation | CKNGICVSSDQNHFR CCCCEEECCCCCCCC | 24.64 | - | |
| 141 | Phosphorylation | KNGICVSSDQNHFRG CCCEEECCCCCCCCC | 23.87 | - | |
| 155 | O-linked_Glycosylation | GEIEETITESFGNDH CCHHHHHHHHHCCCC | 32.75 | 55823919 | |
| 163 | O-linked_Glycosylation | ESFGNDHSTLDGYSR HHHCCCCCCCCCCCC | 33.26 | 55823923 | |
| 164 | O-linked_Glycosylation | SFGNDHSTLDGYSRR HHCCCCCCCCCCCCC | 26.00 | 55823927 | |
| 169 | O-linked_Glycosylation | HSTLDGYSRRTTLSS CCCCCCCCCCEECCC | 22.33 | 55823931 | |
| 172 | O-linked_Glycosylation | LDGYSRRTTLSSKMY CCCCCCCEECCCCEE | 30.86 | 55823935 | |
| 173 | O-linked_Glycosylation | DGYSRRTTLSSKMYH CCCCCCEECCCCEEE | 23.88 | 55823941 | |
| 181 | O-linked_Glycosylation | LSSKMYHTKGQEGSV CCCCEEECCCCCCCE | 21.27 | 55826845 | |
| 221 | Phosphorylation | LKEGQVCTKHRRKGS HHCCCEECCCCCCCC | 30.91 | - | |
| 228 | Phosphorylation | TKHRRKGSHGLEIFQ CCCCCCCCCHHHHHC | 19.88 | 26091039 | |
| 255 | Phosphorylation | QKDHHQASNSSRLHT CCCHHCCCCCCCCCC | 30.58 | - | |
| 256 | N-linked_Glycosylation | KDHHQASNSSRLHTC CCHHCCCCCCCCCCC | 47.20 | 21805521 | |
| 257 | Phosphorylation | DHHQASNSSRLHTCQ CHHCCCCCCCCCCCC | 17.84 | - | |
| 258 | Phosphorylation | HHQASNSSRLHTCQR HHCCCCCCCCCCCCC | 43.01 | - | |
| 262 | Phosphorylation | SNSSRLHTCQRH--- CCCCCCCCCCCC--- | 18.22 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DKK1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DKK1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DKK1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| COR1A_HUMAN | CORO1A | physical | 17353931 | |
| MDFI_HUMAN | MDFI | physical | 19060904 | |
| DPP4_HUMAN | DPP4 | physical | 21988832 | |
| LRP6_HUMAN | LRP6 | physical | 11448771 | |
| KR101_HUMAN | KRTAP10-1 | physical | 25416956 | |
| LRP6_HUMAN | LRP6 | physical | 26186194 | |
| LRP5_HUMAN | LRP5 | physical | 26186194 | |
| POTEI_HUMAN | POTEI | physical | 26186194 | |
| PSD13_HUMAN | PSMD13 | physical | 26186194 | |
| RBM45_HUMAN | RBM45 | physical | 26186194 | |
| PSMD6_HUMAN | PSMD6 | physical | 26186194 | |
| KITM_HUMAN | TK2 | physical | 26186194 | |
| FBLN1_HUMAN | FBLN1 | physical | 26186194 | |
| AMZ2_HUMAN | AMZ2 | physical | 26186194 | |
| CTNB1_HUMAN | CTNNB1 | physical | 25241761 | |
| KITM_HUMAN | TK2 | physical | 28514442 | |
| RBM45_HUMAN | RBM45 | physical | 28514442 | |
| LRP6_HUMAN | LRP6 | physical | 28514442 | |
| POTEI_HUMAN | POTEI | physical | 28514442 | |
| LRP5_HUMAN | LRP5 | physical | 28514442 | |
| PSMD6_HUMAN | PSMD6 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| N-linked Glycosylation | |
| Reference | PubMed |
| "Human Dickkopf-1 (huDKK1) protein: characterization of glycosylationand determination of disulfide linkages in the two cysteine-richdomains."; Haniu M., Horan T., Spahr C., Hui J., Fan W., Chen C., Richards W.G.,Lu H.S.; Protein Sci. 20:1802-1813(2011). Cited for: GLYCOSYLATION AT SER-61 AND ASN-256, AND DISULFIDE BONDS. | |
| O-linked Glycosylation | |
| Reference | PubMed |
| "Human Dickkopf-1 (huDKK1) protein: characterization of glycosylationand determination of disulfide linkages in the two cysteine-richdomains."; Haniu M., Horan T., Spahr C., Hui J., Fan W., Chen C., Richards W.G.,Lu H.S.; Protein Sci. 20:1802-1813(2011). Cited for: GLYCOSYLATION AT SER-61 AND ASN-256, AND DISULFIDE BONDS. | |
