UniProt ID | RSLBB_HUMAN | |
---|---|---|
UniProt AC | Q9BPW5 | |
Protein Name | Ras-like protein family member 11B | |
Gene Name | RASL11B {ECO:0000312|EMBL:AAH01846.1} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 248 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MRLIQNMCTIAEYPAPGNAAASDCCVGAAGRRLVKIAVVGASGVGKTALVVRFLTKRFIGDYERNAGNLYTRQVQIEGETLALQVQDTPGIQVHENSLSCSEQLNRCIRWADAVVIVFSITDYKSYELISQLHQHVQQLHLGTRLPVVVVANKADLLHIKQVDPQLGLQLASMLGCSFYEVSVSENYNDVYSAFHVLCKEVSHKQQPSSTPEKRRTSLIPRPKSPNMQDLKRRFKQALSAKVRTVTSV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
42 | Phosphorylation | KIAVVGASGVGKTAL EEEEECCCCCCHHHH | 28.25 | 22468782 | |
121 | Phosphorylation | VVIVFSITDYKSYEL EEEEEECCCHHHHHH | 31.88 | - | |
123 | Phosphorylation | IVFSITDYKSYELIS EEEECCCHHHHHHHH | 7.99 | 21403953 | |
209 | Phosphorylation | SHKQQPSSTPEKRRT CCCCCCCCCCCHHHC | 55.45 | 24719451 | |
224 | Phosphorylation | SLIPRPKSPNMQDLK CCCCCCCCCCHHHHH | 24.96 | 28857561 | |
239 | Phosphorylation | RRFKQALSAKVRTVT HHHHHHHHHHEEEEE | 29.12 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RSLBB_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RSLBB_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RSLBB_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...