| UniProt ID | LIRA3_HUMAN | |
|---|---|---|
| UniProt AC | Q8N6C8 | |
| Protein Name | Leukocyte immunoglobulin-like receptor subfamily A member 3 | |
| Gene Name | LILRA3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 439 | |
| Subcellular Localization | Secreted . | |
| Protein Description | Acts as soluble receptor for class I MHC antigens. Binds both classical and non-classical HLA class I molecules but with reduced affinities compared to LILRB1 or LILRB2. Binds with high affinity to the surface of monocytes, leading to abolish LPS-induced TNF-alpha production by monocytes.. | |
| Protein Sequence | MTPILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 89 | Phosphorylation | QFPILSITWEHAGRY CCCEEEEECEECCCE | 22.79 | 18785766 | |
| 140 | N-linked_Glycosylation | PVVTSGGNVTIQCDS CEEECCCCEEEECCC | 31.14 | 24085305 | |
| 170 | Phosphorylation | EHPQCLNSHSHARGS CCCCHHHCCCCCCCC | 17.26 | - | |
| 172 | Phosphorylation | PQCLNSHSHARGSSR CCHHHCCCCCCCCCC | 20.75 | - | |
| 194 | Phosphorylation | VSPSRRWSYRCYGYD CCCCCCEEEEEECCC | 10.82 | - | |
| 281 | N-linked_Glycosylation | QAGLSQANFTLGPVS CCCCCCCCEEECCCC | 23.85 | 24085305 | |
| 302 | N-linked_Glycosylation | YTCSGAYNLSSEWSA EEECCCEECCCCCCC | 32.67 | 24085305 | |
| 341 | N-linked_Glycosylation | PTVASGENVTLLCQS CEECCCCCEEEEEEC | 35.28 | 24085305 | |
| 378 | Phosphorylation | SKRQSHKYQAEFPMS CHHHHCCEEEECCCC | 13.92 | - | |
| 385 | Phosphorylation | YQAEFPMSPVTSAHA EEEECCCCCCCCCCC | 19.22 | - | |
| 431 | N-linked_Glycosylation | ETLSPPQNKSDSKAG HCCCCCCCCCCCCCC | 52.12 | 24085305 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LIRA3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LIRA3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LIRA3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MYCB2_HUMAN | MYCBP2 | physical | 26186194 | |
| SYNC_HUMAN | NARS | physical | 26186194 | |
| LIRA1_HUMAN | LILRA1 | physical | 26186194 | |
| LIRB1_HUMAN | LILRB1 | physical | 26186194 | |
| LIRB1_HUMAN | LILRB1 | physical | 28514442 | |
| LIRA1_HUMAN | LILRA1 | physical | 28514442 | |
| SYNC_HUMAN | NARS | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
