UniProt ID | UBFD1_HUMAN | |
---|---|---|
UniProt AC | O14562 | |
Protein Name | Ubiquitin domain-containing protein UBFD1 | |
Gene Name | UBFD1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 309 | |
Subcellular Localization | ||
Protein Description | May play a role as NF-kappa-B regulator.. | |
Protein Sequence | MAAAGAPDGMEEPGMDTEAETVATEAPARPVNCLEAEAAAGAAAEDSGAARGSLQPAPAQPPGDPAAQASVSNGEDAGGGAGRELVDLKIIWNKTKHDVKFPLDSTGSELKQKIHSITGLPPAMQKVMYKGLVPEDKTLREIKVTSGAKIMVVGSTINDVLAVNTPKDAAQQDAKAEENKKEPLCRQKQHRKVLDKGKPEDVMPSVKGAQERLPTVPLSGMYNKSGGKVRLTFKLEQDQLWIGTKERTEKLPMGSIKNVVSEPIEGHEDYHMMAFQLGPTEASYYWVYWVPTQYVDAIKDTVLGKWQYF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
70 | Phosphorylation | GDPAAQASVSNGEDA CCHHHHHHCCCCCCC | 17.63 | 19060867 | |
72 | Phosphorylation | PAAQASVSNGEDAGG HHHHHHCCCCCCCCC | 36.30 | 26657352 | |
89 | Ubiquitination | GRELVDLKIIWNKTK CCEEEEEEEEEECCC | 27.90 | 32015554 | |
94 | Ubiquitination | DLKIIWNKTKHDVKF EEEEEEECCCCCCCC | 43.91 | 21890473 | |
94 | Ubiquitination | DLKIIWNKTKHDVKF EEEEEEECCCCCCCC | 43.91 | 27667366 | |
96 | Ubiquitination | KIIWNKTKHDVKFPL EEEEECCCCCCCCCC | 39.14 | 22817900 | |
100 | Ubiquitination | NKTKHDVKFPLDSTG ECCCCCCCCCCCCCC | 47.52 | 21890473 | |
100 | Ubiquitination | NKTKHDVKFPLDSTG ECCCCCCCCCCCCCC | 47.52 | 27667366 | |
106 | Phosphorylation | VKFPLDSTGSELKQK CCCCCCCCCHHHHHH | 44.38 | 25627689 | |
108 | Phosphorylation | FPLDSTGSELKQKIH CCCCCCCHHHHHHHH | 39.58 | 25627689 | |
111 | Ubiquitination | DSTGSELKQKIHSIT CCCCHHHHHHHHHHH | 45.56 | 21890473 | |
111 | Ubiquitination | DSTGSELKQKIHSIT CCCCHHHHHHHHHHH | 45.56 | 27667366 | |
113 | Ubiquitination | TGSELKQKIHSITGL CCHHHHHHHHHHHCC | 40.58 | 22817900 | |
113 | Ubiquitination | TGSELKQKIHSITGL CCHHHHHHHHHHHCC | 40.58 | 21890473 | |
116 | Phosphorylation | ELKQKIHSITGLPPA HHHHHHHHHHCCCHH | 25.89 | 21406692 | |
118 | Phosphorylation | KQKIHSITGLPPAMQ HHHHHHHHCCCHHHH | 35.36 | 30266825 | |
126 | Ubiquitination | GLPPAMQKVMYKGLV CCCHHHHHHHHCCCC | 18.84 | 21890473 | |
126 | Ubiquitination | GLPPAMQKVMYKGLV CCCHHHHHHHHCCCC | 18.84 | 23000965 | |
126 | Acetylation | GLPPAMQKVMYKGLV CCCHHHHHHHHCCCC | 18.84 | 23954790 | |
130 | Ubiquitination | AMQKVMYKGLVPEDK HHHHHHHCCCCCCCC | 27.89 | 23000965 | |
137 | Ubiquitination | KGLVPEDKTLREIKV CCCCCCCCCHHEEEE | 48.04 | 33845483 | |
143 | Ubiquitination | DKTLREIKVTSGAKI CCCHHEEEECCCCEE | 34.41 | 27667366 | |
146 | Phosphorylation | LREIKVTSGAKIMVV HHEEEECCCCEEEEE | 39.48 | 22817900 | |
149 | Ubiquitination | IKVTSGAKIMVVGST EEECCCCEEEEEECC | 34.56 | 22817900 | |
149 | Ubiquitination | IKVTSGAKIMVVGST EEECCCCEEEEEECC | 34.56 | 21890473 | |
151 | Sulfoxidation | VTSGAKIMVVGSTIN ECCCCEEEEEECCHH | 1.65 | 21406390 | |
165 | Phosphorylation | NDVLAVNTPKDAAQQ HHHHCCCCCHHHHHH | 25.72 | 27050516 | |
167 | Ubiquitination | VLAVNTPKDAAQQDA HHCCCCCHHHHHHHH | 58.94 | 21906983 | |
175 | Ubiquitination | DAAQQDAKAEENKKE HHHHHHHHHHHHCCC | 65.70 | 33845483 | |
180 | Ubiquitination | DAKAEENKKEPLCRQ HHHHHHHCCCCCHHH | 62.89 | 29967540 | |
181 | Ubiquitination | AKAEENKKEPLCRQK HHHHHHCCCCCHHHH | 75.93 | 29967540 | |
196 | Ubiquitination | QHRKVLDKGKPEDVM HHHHHHHCCCHHHCC | 65.75 | 24816145 | |
196 | Acetylation | QHRKVLDKGKPEDVM HHHHHHHCCCHHHCC | 65.75 | 25953088 | |
203 | Sulfoxidation | KGKPEDVMPSVKGAQ CCCHHHCCCCCCCHH | 2.95 | 30846556 | |
207 | Ubiquitination | EDVMPSVKGAQERLP HHCCCCCCCHHHHCC | 53.52 | 23503661 | |
219 | Phosphorylation | RLPTVPLSGMYNKSG HCCCCCCCEEEECCC | 18.55 | 29759185 | |
222 | Phosphorylation | TVPLSGMYNKSGGKV CCCCCEEEECCCCEE | 23.98 | 29759185 | |
224 | Malonylation | PLSGMYNKSGGKVRL CCCEEEECCCCEEEE | 32.75 | 26320211 | |
224 | Ubiquitination | PLSGMYNKSGGKVRL CCCEEEECCCCEEEE | 32.75 | 22817900 | |
225 | Phosphorylation | LSGMYNKSGGKVRLT CCEEEECCCCEEEEE | 49.49 | 29759185 | |
228 | Ubiquitination | MYNKSGGKVRLTFKL EEECCCCEEEEEEEE | 27.92 | 22817900 | |
245 | Ubiquitination | DQLWIGTKERTEKLP CEEEEEECCCCCCCC | 39.73 | 23000965 | |
245 | Ubiquitination | DQLWIGTKERTEKLP CEEEEEECCCCCCCC | 39.73 | 21890473 | |
245 | Malonylation | DQLWIGTKERTEKLP CEEEEEECCCCCCCC | 39.73 | 32601280 | |
250 | Malonylation | GTKERTEKLPMGSIK EECCCCCCCCCCCCE | 58.22 | 26320211 | |
250 | Ubiquitination | GTKERTEKLPMGSIK EECCCCCCCCCCCCE | 58.22 | 23000965 | |
299 | Ubiquitination | TQYVDAIKDTVLGKW HHHHHHHHHHHCCCC | 49.41 | 23000965 | |
305 | Ubiquitination | IKDTVLGKWQYF--- HHHHHCCCCCCC--- | 27.28 | 21890473 | |
305 | Ubiquitination | IKDTVLGKWQYF--- HHHHHCCCCCCC--- | 27.28 | 23000965 | |
308 | Phosphorylation | TVLGKWQYF------ HHCCCCCCC------ | 15.33 | - | |
318 | Ubiquitination | ---------------- ---------------- | 21890473 | ||
324 | Ubiquitination | ---------------------- ---------------------- | 21890473 | ||
335 | Ubiquitination | --------------------------------- --------------------------------- | 21890473 | ||
337 | Ubiquitination | ----------------------------------- ----------------------------------- | 21890473 | ||
350 | Ubiquitination | ------------------------------------------------ ------------------------------------------------ | 21890473 | ||
373 | Ubiquitination | ----------------------------------------------------------------------- ----------------------------------------------------------------------- | 21890473 | ||
391 | Ubiquitination | ----------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------- | 21890473 | ||
448 | Ubiquitination | -------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------- | 21890473 | ||
469 | Ubiquitination | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- | 21890473 | ||
529 | Ubiquitination | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBFD1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBFD1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBFD1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HNRPK_HUMAN | HNRNPK | physical | 22863883 | |
RUXF_HUMAN | SNRPF | physical | 22863883 | |
IF4E_HUMAN | EIF4E | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...