UniProt ID | PAX9_HUMAN | |
---|---|---|
UniProt AC | P55771 | |
Protein Name | Paired box protein Pax-9 | |
Gene Name | PAX9 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 341 | |
Subcellular Localization | Nucleus. | |
Protein Description | Transcription factor required for normal development of thymus, parathyroid glands, ultimobranchial bodies, teeth, skeletal elements of skull and larynx as well as distal limbs.. | |
Protein Sequence | MEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIGNLAQQGHYDSYKQHQPTPQPALPYNHIYSYPSPITAAAAKVPTPPGVPAIPGSVAMPRTWPSSHSVTDILGIRSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGHGWQHAGGTSLSPHNCDIPASLAFKGMQAAREGSHSVTASAL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
60 | Phosphorylation | VSKILARYNETGSIL HHHHHHHHCCCCCCC | 16.25 | 22210691 | |
63 | Phosphorylation | ILARYNETGSILPGA HHHHHCCCCCCCCCC | 32.37 | 22210691 | |
65 | Phosphorylation | ARYNETGSILPGAIG HHHCCCCCCCCCCCC | 28.50 | 22210691 | |
114 | Ubiquitination | LADGVCDKYNVPSVS HHCCCCCCCCCCCHH | 33.33 | - | |
140 | Phosphorylation | NLAQQGHYDSYKQHQ HHHHCCCCCCCCCCC | 17.26 | 27642862 | |
143 | Phosphorylation | QQGHYDSYKQHQPTP HCCCCCCCCCCCCCC | 16.27 | 27642862 | |
144 | Ubiquitination | QGHYDSYKQHQPTPQ CCCCCCCCCCCCCCC | 45.30 | - | |
175 | Phosphorylation | AAAAKVPTPPGVPAI HHHCCCCCCCCCCCC | 45.14 | 25159151 | |
194 | Phosphorylation | AMPRTWPSSHSVTDI CCCCCCCCCCCHHHH | 32.04 | 27251275 | |
195 | Phosphorylation | MPRTWPSSHSVTDIL CCCCCCCCCCHHHHC | 18.72 | 27251275 | |
197 | Phosphorylation | RTWPSSHSVTDILGI CCCCCCCCHHHHCCC | 28.76 | 27251275 | |
208 | Phosphorylation | ILGIRSITDQVSDSS HCCCEECCCCCCCCC | 22.94 | 29759185 | |
212 | Phosphorylation | RSITDQVSDSSPYHS EECCCCCCCCCCCCC | 26.58 | 25072903 | |
214 | Phosphorylation | ITDQVSDSSPYHSPK CCCCCCCCCCCCCCC | 26.21 | 23898821 | |
215 | Phosphorylation | TDQVSDSSPYHSPKV CCCCCCCCCCCCCCH | 34.17 | 21815630 | |
217 | Phosphorylation | QVSDSSPYHSPKVEE CCCCCCCCCCCCHHH | 19.51 | 29759185 | |
219 | Phosphorylation | SDSSPYHSPKVEEWS CCCCCCCCCCHHHHH | 22.14 | 21815630 | |
226 | Phosphorylation | SPKVEEWSSLGRNNF CCCHHHHHHHCCCCC | 20.97 | 23898821 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAX9_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAX9_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAX9_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SSX4_HUMAN | SSX4 | physical | 20211142 | |
TLE1_HUMAN | TLE1 | physical | 20211142 | |
TLE2_HUMAN | TLE2 | physical | 20211142 | |
NR0B2_HUMAN | NR0B2 | physical | 20211142 | |
FUBP3_HUMAN | FUBP3 | physical | 20211142 | |
TRIP4_HUMAN | TRIP4 | physical | 20211142 | |
TF2AY_HUMAN | GTF2A1L | physical | 20211142 | |
ZN580_HUMAN | ZNF580 | physical | 20211142 | |
ZN440_HUMAN | ZNF440 | physical | 20211142 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...