SSX4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SSX4_HUMAN
• UniProt AC: O60224
• Protein Name: Protein SSX4
• Gene Name: SSX4
• Organism: Homo sapiens (Human).
• Sequence Length: 188
• Protein Description: Could act as a modulator of transcription..
• Protein Sequence: MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
35	Acetylation	IAKYFSKKEWEKMKS HHHHHCHHHHHHCCC	67.85	24467987
48	Phosphorylation	KSSEKIVYVYMKLNY CCCCCEEEEEECCCH	6.85	28270605
50	Phosphorylation	SEKIVYVYMKLNYEV CCCEEEEEECCCHHH	3.20	29116813
55	Phosphorylation	YVYMKLNYEVMTKLG EEEECCCHHHHHHHC	21.97	29116813
59	Phosphorylation	KLNYEVMTKLGFKVT CCCHHHHHHHCCEEE	28.44	29116813

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SSX4_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SSX4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SSX4_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
XBP1_HUMAN	XBP1	physical	20211142
LZTR1_HUMAN	LZTR1	physical	20211142

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.