UniProt ID | SSX4_HUMAN | |
---|---|---|
UniProt AC | O60224 | |
Protein Name | Protein SSX4 | |
Gene Name | SSX4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 188 | |
Subcellular Localization | ||
Protein Description | Could act as a modulator of transcription.. | |
Protein Sequence | MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
35 | Acetylation | IAKYFSKKEWEKMKS HHHHHCHHHHHHCCC | 67.85 | 24467987 | |
48 | Phosphorylation | KSSEKIVYVYMKLNY CCCCCEEEEEECCCH | 6.85 | 28270605 | |
50 | Phosphorylation | SEKIVYVYMKLNYEV CCCEEEEEECCCHHH | 3.20 | 29116813 | |
55 | Phosphorylation | YVYMKLNYEVMTKLG EEEECCCHHHHHHHC | 21.97 | 29116813 | |
59 | Phosphorylation | KLNYEVMTKLGFKVT CCCHHHHHHHCCEEE | 28.44 | 29116813 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SSX4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SSX4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SSX4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
XBP1_HUMAN | XBP1 | physical | 20211142 | |
LZTR1_HUMAN | LZTR1 | physical | 20211142 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...