UniProt ID | ZN580_HUMAN | |
---|---|---|
UniProt AC | Q9UK33 | |
Protein Name | Zinc finger protein 580 | |
Gene Name | ZNF580 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 172 | |
Subcellular Localization | Nucleus . Colocalized with SMAD2 in the nucleus. | |
Protein Description | Involved in the regulation of endothelial cell proliferation and migration. Mediates H(2)O(2)-induced leukocyte chemotaxis by elevating interleukin-8 production and may play a role in inflammation. May be involved in transcriptional regulation.. | |
Protein Sequence | MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLEEEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPFTCGACGKAFKRSSHLSRHRATHRARAGPPHTCPLCPRRFQDAAELAQHVRLH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Phosphorylation | PRPPHPRSSSPEAMD CCCCCCCCCCCCCCC | 39.35 | 23401153 | |
14 | Phosphorylation | RPPHPRSSSPEAMDP CCCCCCCCCCCCCCC | 51.71 | 30266825 | |
15 | Phosphorylation | PPHPRSSSPEAMDPP CCCCCCCCCCCCCCC | 28.18 | 30266825 | |
31 | Sumoylation | PKAPPFPKAEGPSST CCCCCCCCCCCCCCC | 60.49 | 28112733 | |
37 | Phosphorylation | PKAEGPSSTPSSAAG CCCCCCCCCCCCCCC | 47.69 | 28555341 | |
38 | Phosphorylation | KAEGPSSTPSSAAGP CCCCCCCCCCCCCCC | 31.37 | 28555341 | |
90 | Ubiquitination | PGEPGPRKGYSCPEC CCCCCCCCCCCCHHH | 66.39 | - | |
103 | Phosphorylation | ECARVFASPLRLQSH HHHHHHCCCCHHCCC | 17.01 | 30266825 | |
113 | Phosphorylation | RLQSHRVSHSDLKPF HHCCCCCCHHHCCCC | 19.75 | - | |
115 | Phosphorylation | QSHRVSHSDLKPFTC CCCCCCHHHCCCCCC | 36.81 | 29214152 | |
118 | Sumoylation | RVSHSDLKPFTCGAC CCCHHHCCCCCCCCC | 42.97 | 28112733 | |
121 | Phosphorylation | HSDLKPFTCGACGKA HHHCCCCCCCCCCHH | 20.68 | - | |
133 | Phosphorylation | GKAFKRSSHLSRHRA CHHHHHHHHHHHHHH | 32.26 | 23663014 | |
136 | Phosphorylation | FKRSSHLSRHRATHR HHHHHHHHHHHHHHH | 22.18 | 23663014 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN580_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN580_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN580_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
T22D4_HUMAN | TSC22D4 | physical | 16189514 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...