DNJB3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DNJB3_HUMAN
• UniProt AC: Q8WWF6
• Protein Name: DnaJ homolog subfamily B member 3
• Gene Name: DNAJB3
• Organism: Homo sapiens (Human).
• Sequence Length: 145
• Protein Description: May operate as a co-chaperone of the male germ cell- and haploid stage-specific Hsp70 proteins..
• Protein Sequence: MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGEAGAEGGCTGGRPFEDPFEYVFSFRDPADVFREFFGGQDPFSFDLLGNPLENILGGSEELLGKQKQSVCTPFLCLQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	Ubiquitination	AIKKAYRKLALKWHP HHHHHHHHHHHHCCC	25.99	23000965
29	Ubiquitination	AYRKLALKWHPDKNP HHHHHHHHCCCCCCC	37.54	23000965
34	Ubiquitination	ALKWHPDKNPENKEE HHHCCCCCCCCCHHH	78.01	23000965
39	Ubiquitination	PDKNPENKEEAERRF CCCCCCCHHHHHHHH	56.10	23503661
47	Ubiquitination	EEAERRFKQVAEAYE HHHHHHHHHHHHHHH	41.89	29901268
53	Phosphorylation	FKQVAEAYEVLSDAK HHHHHHHHHHHHHHH	9.70	21082442
57	Phosphorylation	AEAYEVLSDAKKRDI HHHHHHHHHHHHCCH	40.47	-
60	Ubiquitination	YEVLSDAKKRDIYDR HHHHHHHHHCCHHHH	54.02	21906983
61	Ubiquitination	EVLSDAKKRDIYDRY HHHHHHHHCCHHHHC	57.96	21963094
68	Phosphorylation	KRDIYDRYGEAGAEG HCCHHHHCCCCCCCC	19.20	21406692
78	Phosphorylation	AGAEGGCTGGRPFED CCCCCCCCCCCCCCC	46.04	21406692
92	Phosphorylation	DPFEYVFSFRDPADV CCCEEEEEECCHHHH	14.88	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DNJB3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DNJB3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DNJB3_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of DNJB3_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.