SPT4H_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPT4H_HUMAN
• UniProt AC: P63272
• Protein Name: Transcription elongation factor SPT4
• Gene Name: SUPT4H1
• Organism: Homo sapiens (Human).
• Sequence Length: 117
• Subcellular Localization: Nucleus .
• Protein Description: Component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II. DSIF positively regulates mRNA capping by stimulating the mRNA guanylyltransferase activity of RNGTT/CAP1A. DSIF also acts cooperatively with the negative elongation factor complex (NELF complex) to enhance transcriptional pausing at sites proximal to the promoter. Transcriptional pausing may facilitate the assembly of an elongation competent RNA polymerase II complex. DSIF and NELF promote pausing by inhibition of the transcription elongation factor TFIIS/S-II. TFIIS/S-II binds to RNA polymerase II at transcription pause sites and stimulates the weak intrinsic nuclease activity of the enzyme. Cleavage of blocked transcripts by RNA polymerase II promotes the resumption of transcription from the new 3' terminus and may allow repeated attempts at transcription through natural pause sites. DSIF can also positively regulate transcriptional elongation and is required for the efficient activation of transcriptional elongation by the HIV-1 nuclear transcriptional activator, Tat. DSIF acts to suppress transcriptional pausing in transcripts derived from the HIV-1 LTR and blocks premature release of HIV-1 transcripts at terminator sequences..
• Protein Sequence: MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MALETVPKD ------CCCCCCCHH	17.69	22814378
5	Phosphorylation	---MALETVPKDLRH ---CCCCCCCHHHHH	42.85	22985185
8	Ubiquitination	MALETVPKDLRHLRA CCCCCCCHHHHHHHH	66.12	23000965
43	Ubiquitination	CDAYLQMKGNREMVY CHHEEEECCCCCCEE	39.82	22817900
56	Phosphorylation	VYDCTSSSFDGIIAM EEECCCCCCCEEEEE	27.42	-
78	Phosphorylation	VSKWQRVSNFKPGVY HHCCEEHHCCCCCEE	38.44	-
81	Ubiquitination	WQRVSNFKPGVYAVS CEEHHCCCCCEEEEE	45.15	23000965
85	Phosphorylation	SNFKPGVYAVSVTGR HCCCCCEEEEEEECC	13.75	29496907
108	Phosphorylation	LKSRGVAYKSRDTAI HHHCCCEEECCCCCC	13.69	23532336
109	Acetylation	KSRGVAYKSRDTAIK HHCCCEEECCCCCCC	29.31	25953088
109	Ubiquitination	KSRGVAYKSRDTAIK HHCCCEEECCCCCCC	29.31	27667366
110	Phosphorylation	SRGVAYKSRDTAIKT HCCCEEECCCCCCCC	23.78	23532336

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPT4H_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPT4H_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPT4H_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SPT5H_HUMAN	SUPT5H	physical	19860741
NSG2_HUMAN	HMP19	physical	21900206
PDLI1_HUMAN	PDLIM1	physical	21900206
LRIF1_HUMAN	LRIF1	physical	21900206
A4_HUMAN	APP	physical	21832049
SPT5H_HUMAN	SUPT5H	physical	22939629
TAT_HV1H2	tat	physical	11112772

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.