UniProt ID | NSG2_HUMAN | |
---|---|---|
UniProt AC | Q9Y328 | |
Protein Name | Neuronal vesicle trafficking-associated protein 2 {ECO:0000312|HGNC:HGNC:24955} | |
Gene Name | NSG2 {ECO:0000312|HGNC:HGNC:24955} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 171 | |
Subcellular Localization |
Membrane Single-pass type II membrane protein . Golgi apparatus, trans-Golgi network membrane . Cell projection, dendrite . Endosome membrane . Early endosome membrane . Late endosome membrane . Lysosome lumen . Cytoplasmic vesicle membrane . Golgi appa |
|
Protein Description | ||
Protein Sequence | MVKLNSNPSEKGTKPPSVEDGFQTVPLITPLEVNHLQLPAPEKVIVKTRTEYQPEQKNKGKFRVPKIAEFTVTILVSLALAFLACIVFLVVYKAFTYDHSCPEGFVYKHKRCIPASLDAYYSSQDPNSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEPKPPKTQGH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
29 | Phosphorylation | FQTVPLITPLEVNHL CCCCCEECCEEECCC | 29.51 | - | |
52 | Phosphorylation | IVKTRTEYQPEQKNK EEEECCCCCHHHCCC | 28.84 | 25884760 | |
57 | Ubiquitination | TEYQPEQKNKGKFRV CCCCHHHCCCCCCCC | 59.99 | 32142685 | |
59 | Ubiquitination | YQPEQKNKGKFRVPK CCHHHCCCCCCCCCH | 71.20 | 30230243 | |
116 | Phosphorylation | HKRCIPASLDAYYSS CCCEEEHHHHHHHCC | 22.79 | - | |
133 | Phosphorylation | PNSRSRFYTVISHYS CCCCHHHEEECCHHH | 10.05 | 22461510 | |
139 | Phosphorylation | FYTVISHYSVAKQST HEEECCHHHHHCHHH | 9.69 | 22461510 | |
140 | Phosphorylation | YTVISHYSVAKQSTA EEECCHHHHHCHHHH | 15.35 | 22461510 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NSG2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NSG2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NSG2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
S35F6_HUMAN | SLC35F6 | physical | 16169070 | |
ZN768_HUMAN | ZNF768 | physical | 21900206 | |
ECM1_HUMAN | ECM1 | physical | 28514442 | |
ASAH1_HUMAN | ASAH1 | physical | 28514442 | |
GRP78_HUMAN | HSPA5 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...