UniProt ID | ECM1_HUMAN | |
---|---|---|
UniProt AC | Q16610 | |
Protein Name | Extracellular matrix protein 1 | |
Gene Name | ECM1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 540 | |
Subcellular Localization | Secreted, extracellular space, extracellular matrix. | |
Protein Description | Involved in endochondral bone formation as negative regulator of bone mineralization. Stimulates the proliferation of endothelial cells and promotes angiogenesis. Inhibits MMP9 proteolytic activity.. | |
Protein Sequence | MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAPFGDQSHPEPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLVWEEAMSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQLRACPSHQPDISSGLELPFPPGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWKAWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MGTTARAALV -----CCHHHHHHHH | 18.91 | - | |
12 | Phosphorylation | ARAALVLTYLAVASA HHHHHHHHHHHHHHH | 14.71 | 23532336 | |
18 | Phosphorylation | LTYLAVASAASEGGF HHHHHHHHHHHHCCC | 20.12 | 24719451 | |
43 | Phosphorylation | EHFQEVGYAAPPSPP HHHHHCCCCCCCCCC | 12.55 | - | |
43 | O-linked_Glycosylation | EHFQEVGYAAPPSPP HHHHHCCCCCCCCCC | 12.55 | 30806347 | |
48 | Phosphorylation | VGYAAPPSPPLSRSL CCCCCCCCCCCCCCC | 37.78 | 26091039 | |
48 | O-linked_Glycosylation | VGYAAPPSPPLSRSL CCCCCCCCCCCCCCC | 37.78 | 55833179 | |
52 | Phosphorylation | APPSPPLSRSLPMDH CCCCCCCCCCCCCCC | 26.12 | 26091039 | |
63 | O-linked_Glycosylation | PMDHPDSSQHGPPFE CCCCCCHHHCCCCCC | 33.31 | OGP | |
80 | O-linked_Glycosylation | SQVQPPPSQEATPLQ CCCCCCCCCCCCCCC | 46.56 | OGP | |
80 | Phosphorylation | SQVQPPPSQEATPLQ CCCCCCCCCCCCCCC | 46.56 | 24505115 | |
84 | O-linked_Glycosylation | PPPSQEATPLQQEKL CCCCCCCCCCCHHHC | 24.63 | OGP | |
119 | O-linked_Glycosylation | PLQKELPSLQHPNEQ CHHHHCCCCCCCCCC | 53.97 | 55824565 | |
130 | O-linked_Glycosylation | PNEQKEGTPAPFGDQ CCCCCCCCCCCCCCC | 19.85 | OGP | |
138 | O-linked_Glycosylation | PAPFGDQSHPEPESW CCCCCCCCCCCCCCC | 45.83 | OGP | |
354 | N-linked_Glycosylation | RCCRQGNNHTCTWKA HHHHHCCCCCEEEHH | 38.37 | UniProtKB CARBOHYD | |
369 | Phosphorylation | WEDTLDKYCDREYAV HHHHHHHHHCHHHHH | 10.15 | 22468782 | |
374 | Phosphorylation | DKYCDREYAVKTHHH HHHHCHHHHHHCCCC | 20.00 | 22468782 | |
378 | Phosphorylation | DREYAVKTHHHLCCR CHHHHHHCCCCCCCC | 21.60 | 22468782 | |
391 | O-linked_Glycosylation | CRHPPSPTRDECFAR CCCCCCCCHHHHHHH | 55.90 | 55829579 | |
411 | Phosphorylation | NYDRDILTIDIGRVT CCCCCEEEEECCCCC | 19.55 | 24719451 | |
418 | Phosphorylation | TIDIGRVTPNLMGHL EEECCCCCCCHHHHH | 12.71 | - | |
433 | Phosphorylation | CGNQRVLTKHKHIPG HCCCHHHCCCCCCCC | 28.39 | - | |
438 | Phosphorylation | VLTKHKHIPGLIHNM HHCCCCCCCCHHHHC | 3.27 | 24719451 | |
444 | N-linked_Glycosylation | HIPGLIHNMTARCCD CCCCHHHHCCCHHCC | 23.62 | 17623646 | |
444 | N-linked_Glycosylation | HIPGLIHNMTARCCD CCCCHHHHCCCHHCC | 23.62 | 16335952 | |
530 | N-linked_Glycosylation | QGSTGGTNISSTSEP CCCCCCCCCCCCCCC | 35.11 | UniProtKB CARBOHYD | |
534 | O-linked_Glycosylation | GGTNISSTSEPKEE- CCCCCCCCCCCCCC- | 30.25 | OGP |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ECM1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ECM1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ECM1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
IRAK3_HUMAN | IRAK3 | physical | 21988832 | |
CPTP_HUMAN | CPTP | physical | 21988832 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
247100 | Lipoid proteinosis (LiP) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Human plasma N-glycoproteome analysis by immunoaffinity subtraction,hydrazide chemistry, and mass spectrometry."; Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E.,Moore R.J., Smith R.D.; J. Proteome Res. 4:2070-2080(2005). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-444, AND MASSSPECTROMETRY. |