| UniProt ID | CPTP_HUMAN | |
|---|---|---|
| UniProt AC | Q5TA50 | |
| Protein Name | Ceramide-1-phosphate transfer protein {ECO:0000303|PubMed:23863933, ECO:0000305} | |
| Gene Name | CPTP {ECO:0000312|HGNC:HGNC:28116} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 214 | |
| Subcellular Localization |
Cytoplasm, cytosol . Golgi apparatus, trans-Golgi network membrane Peripheral membrane protein . Cell membrane Peripheral membrane protein Cytoplasmic side . Endosome membrane Peripheral membrane protein . Nucleus outer membrane Peripheral membr |
|
| Protein Description | Mediates the intracellular transfer of ceramide-1-phosphate (C1P) between organelle membranes and the cell membrane. Required for normal structure of the Golgi stacks. Can bind phosphoceramides with a variety of aliphatic chains, but has a preference for lipids with saturated C16:0 or monounsaturated C18:1 aliphatic chains, and is inefficient with phosphoceramides containing lignoceryl (C24:0). Plays a role in the regulation of the cellular levels of ceramide-1-phosphate, and thereby contributes to the regulation of phospholipase PLA2G4A activity and the release of arachidonic acid. Has no activity with galactosylceramide, lactosylceramide, sphingomyelin, phosphatidylcholine, phosphatidic acid and ceramide. C1P transfer is stimulated by phosphatidylserine in C1P source vesicles. [PubMed: 28011644 Regulates autophagy, inflammasome mediated IL1B and IL18 processing, and pyroptosis, but not apoptosis] | |
| Protein Sequence | MDDSETGFNLKVVLVSFKQCLDEKEEVLLDPYIASWKGLVRFLNSLGTIFSFISKDVVSKLRIMERLRGGPQSEHYRSLQAMVAHELSNRLVDLERRSHHPESGCRTVLRLHRALHWLQLFLEGLRTSPEDARTSALCADSYNASLAAYHPWVVRRAVTVAFCTLPTREVFLEAMNVGPPEQAVQMLGEALPFIQRVYNVSQKLYAEHSLLDLP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MDDSETGFNLK ----CCCCCCCCCCE | 20068231 | ||
| 6 | Phosphorylation | --MDDSETGFNLKVV --CCCCCCCCCCEEE | 20068231 | ||
| 24 | Ubiquitination | FKQCLDEKEEVLLDP HHHHCCCCHHHHCCH | - | ||
| 35 | Phosphorylation | LLDPYIASWKGLVRF HCCHHHHCHHHHHHH | 24719451 | ||
| 78 | Phosphorylation | PQSEHYRSLQAMVAH CCCHHHHHHHHHHHH | 22210691 | ||
| 88 | Phosphorylation | AMVAHELSNRLVDLE HHHHHHHHHHHHCHH | 22210691 | ||
| 205 | Phosphorylation | YNVSQKLYAEHSLLD HCHHHHHHHHHHCCC | 25693802 | ||
| 209 | Phosphorylation | QKLYAEHSLLDLP-- HHHHHHHHCCCCC-- | 30622161 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CPTP_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CPTP_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CPTP_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ZN451_HUMAN | ZNF451 | physical | 21988832 | |
| SMAD3_HUMAN | SMAD3 | physical | 21988832 | |
| ELOC_HUMAN | TCEB1 | physical | 21988832 | |
| INP5K_HUMAN | INPP5K | physical | 21988832 | |
| PHF13_HUMAN | PHF13 | physical | 21988832 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
